Browse result page of PRRDB 2.0
| PRRID | Name of Ligand | Source of ligand | Sequence of Ligand | Length of Ligand | Type of Ligand | Occurence | Role of Ligand | Name of Receptor | Type of Reeptor | Source of the Receptor | Localization | Domain | Sequence of Receptor | Swiss prot ID | Length of receptor | Function of Receptor | Assay used | PMID | Year of publication | Pubchem assay |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| PRRID_0558 | Histoplasma strain 505 yeast cells Click for more detail | Histoplasma strain 506 (others) | NA | NA | Whole organism | Natural | The binding leads to the secretion of cytokines such as TNF-‚ç∫ and IL-6, via syk dependent pathway | Dectin-1 | C type Lectin (CTL/CLR) | Mice (Murine) | Macropahges | lectin binding domain | Q6QLQ4.fasta | Q6QLQ4 | 244 | It is was responsible for cytokine response. | ELISA | 20360401 | 2010 | Pubchem Assay |
| PRRID_0558 | Histoplasma strain 505 yeast cells Click for more detail | Histoplasma strain 506 (others) | NA | NA | Whole organism | Natural | The binding leads to the secretion of cytokines such as TNF-‚ç∫ and IL-6, via syk dependent pathway | Dectin-1 | C type Lectin (CTL/CLR) | Mice (Murine) | Macropahges | lectin binding domain | Q6QLQ4.fasta | Q6QLQ4 | 244 | It is was responsible for cytokine response. | ELISA | 20360401 | 2010 | Pubchem Assay |
| PRRID_0559 | HMGB1 Click for more detail | Mouse model of endotoxemia | MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE | 215 | Protein | Natural | Acts as a mediator of inflammation and organ damage | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Mice | NA | Leucine-rich Repeat (LRR) Domain | Q9QUK6.fasta | Q9QUK6 | 835 | Acts as a mediator of inflammation and organ damage | NA | 20740341 | 2010 | Pubchem Assay |
| PRRID_0559 | HMGB1 Click for more detail | Mouse model of endotoxemia | MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE | 215 | Protein | Natural | Acts as a mediator of inflammation and organ damage | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Mice | NA | Leucine-rich Repeat (LRR) Domain | Q9QUK6.fasta | Q9QUK6 | 835 | Acts as a mediator of inflammation and organ damage | NA | 20740341 | 2010 | Pubchem Assay |
| PRRID_0560 | HMGB1 Click for more detail | Mouse model of endotoxemia | MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE | 215 | Protein | Natural | Acts as a mediator of inflammation and organ damage | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Mice | NA | Leucine-rich Repeat (LRR) Domain | Q9QUN7.fasta | Q9QUN7 | 784 | Acts as a mediator of inflammation and organ damage | NA | 20740341 | 2010 | Pubchem Assay |
| PRRID_0560 | HMGB1 Click for more detail | Mouse model of endotoxemia | MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE | 215 | Protein | Natural | Acts as a mediator of inflammation and organ damage | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Mice | NA | Leucine-rich Repeat (LRR) Domain | Q9QUN7.fasta | Q9QUN7 | 784 | Acts as a mediator of inflammation and organ damage | NA | 20740341 | 2010 | Pubchem Assay |
| PRRID_0561 | HMGB1 Click for more detail | Mouse model of endotoxemia | MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE | 215 | Protein | Natural | Acts as a mediator of inflammation and organ damage | RAGE | Receptor for advanced glycation endproducts (RAGE) | Mice | NA | Leucine-rich Repeat (LRR) Domain | Q62151.fasta | Q62151 | 402 | Acts as a mediator of inflammation and organ damage | NA | 20740341 | 2010 | Pubchem Assay |
| PRRID_0561 | HMGB1 Click for more detail | Mouse model of endotoxemia | MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE | 215 | Protein | Natural | Acts as a mediator of inflammation and organ damage | RAGE | Receptor for advanced glycation endproducts (RAGE) | Mice | NA | Leucine-rich Repeat (LRR) Domain | Q62151.fasta | Q62151 | 402 | Acts as a mediator of inflammation and organ damage | NA | 20740341 | 2010 | Pubchem Assay |
| PRRID_0563 | HMGB1 Click for more detail | Host (Endogenous) (others) | MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE | 215 | Protein | Natural | Epinephrine directly acts through Mφ β- adrenergic receptor to stimulate HMGB1 secretion from the Mφ in an autocrine manner | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Mice | lung | Leucine-rich Repeat (LRR) Domain | Q9QUK6.fasta | Q9QUK6 | 835 | NA | NA | 20706658 | 2010 | Pubchem Assay |
| PRRID_0563 | HMGB1 Click for more detail | Host (Endogenous) (others) | MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE | 215 | Protein | Natural | Epinephrine directly acts through Mφ β- adrenergic receptor to stimulate HMGB1 secretion from the Mφ in an autocrine manner | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Mice | lung | Leucine-rich Repeat (LRR) Domain | Q9QUK6.fasta | Q9QUK6 | 835 | NA | NA | 20706658 | 2010 | Pubchem Assay |
| PRRID_0567 | HSP72 Click for more detail | Host (Endogenous) (others) | NA | NA | Protein | Natural | increases in MIP-2 release | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Mice | hepatocytes | Leucine-rich Repeat (LRR) Domain | Q9QUK6.fasta | Q9QUK6 | 835 | NA | NA | 20689929 | 2010 | Pubchem Assay |
| PRRID_0567 | HSP72 Click for more detail | Host (Endogenous) (others) | NA | NA | Protein | Natural | increases in MIP-2 release | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Mice | hepatocytes | Leucine-rich Repeat (LRR) Domain | Q9QUK6.fasta | Q9QUK6 | 835 | NA | NA | 20689929 | 2010 | Pubchem Assay |
| PRRID_0569 | Hyaluronan Click for more detail | Prepared by HCL degradation (others) | CC(=O)NC1CC(C(OC1OC2C(C(C(OC2C(=O)[O-])O)O)O)CO)O | NA | Carbohydrate | Synthetic | Its binding leads to the production of interleukin-10, and down-regulated chemokine production. | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | MRL-lpr/lpr Mice | Large intestinal epithelial cells | Leucine-rich Repeat (LRR) Domain | Q9QUK6.fasta | Q9QUK6 | 835 | It modulates Th-1-type autoimmune disease and inflammation by up-regulating SOCS3 expression and down-regulating pleiotrophin expression via TLR-4 in intestinal epithelial cells and hence promotes the survival. | Array Analysis | 20504769 | 2010 | Pubchem Assay |
| PRRID_0569 | Hyaluronan Click for more detail | Prepared by HCL degradation (others) | CC(=O)NC1CC(C(OC1OC2C(C(C(OC2C(=O)[O-])O)O)O)CO)O | NA | Carbohydrate | Synthetic | Its binding leads to the production of interleukin-10, and down-regulated chemokine production. | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | MRL-lpr/lpr Mice | Large intestinal epithelial cells | Leucine-rich Repeat (LRR) Domain | Q9QUK6.fasta | Q9QUK6 | 835 | It modulates Th-1-type autoimmune disease and inflammation by up-regulating SOCS3 expression and down-regulating pleiotrophin expression via TLR-4 in intestinal epithelial cells and hence promotes the survival. | Array Analysis | 20504769 | 2010 | Pubchem Assay |
| PRRID_0570 | Hyaluronic acid Click for more detail | Host (Endogenous) (others) | CC(=O)NC1CC(C(OC1OC2C(C(C(OC2C(=O)[O-])O)O)O)CO)O | NA | Glycosaminoglycan | Natural | Interaction between lower molecular weight HA and TLR leads to decrease in CD44-dependent clearance of HA leads to enhanced lung inflammation and injury | Toll-like receptor 2 (TLR2)/Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Mice | Macropahges | Leucine-rich Repeat (LRR) Domain | NA | NA | NA | It leads to the production of inflammatory chemokines and cytokines | NA | 20689929 | 2010 | NA |
| PRRID_0570 | Hyaluronic acid Click for more detail | Host (Endogenous) (others) | CC(=O)NC1CC(C(OC1OC2C(C(C(OC2C(=O)[O-])O)O)O)CO)O | NA | Glycosaminoglycan | Natural | Interaction between lower molecular weight HA and TLR leads to decrease in CD44-dependent clearance of HA leads to enhanced lung inflammation and injury | Toll-like receptor 2 (TLR2)/Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Mice | Macropahges | Leucine-rich Repeat (LRR) Domain | NA | NA | NA | It leads to the production of inflammatory chemokines and cytokines | NA | 20689929 | 2010 | NA |
| PRRID_0571 | hypomethylated DNA Click for more detail | Virus | NA | NA | Nucleic Acid | Natural | release of proinflammatory cytokines and Pathgen Clearance | Toll-like receptor 9 (TLR9) | Toll-like receptor (TLR) | Mice | NA | Leucine-rich Repeat (LRR) Domain | Q9NR96.fasta | Q9NR96 | 1032 | It has the role in the inflammation. | NA | 20739362 | 2010 | Pubchem Assay |
| PRRID_0571 | hypomethylated DNA Click for more detail | Virus | NA | NA | Nucleic Acid | Natural | release of proinflammatory cytokines and Pathgen Clearance | Toll-like receptor 9 (TLR9) | Toll-like receptor (TLR) | Mice | NA | Leucine-rich Repeat (LRR) Domain | Q9NR96.fasta | Q9NR96 | 1032 | It has the role in the inflammation. | NA | 20739362 | 2010 | Pubchem Assay |
| PRRID_0574 | Imiquimod Click for more detail | imidazoquinoline (others) | CC(C)CN1C=NC2=C1C3=CC=CC=C3N=C2N | NA | Nucleic Acid | Synthetic | It induces inflammatory responses when applied to the skin | Toll-like receptor 7 (TLR7) | Toll-like receptor (TLR) | Mice | NA | Leucine-rich Repeat (LRR) Domain | P58681.fasta | P58681 | 1050 | It leads to the inflammation of the cell | NA | 20739947 | 2010 | Pubchem Assay |
| PRRID_0574 | Imiquimod Click for more detail | imidazoquinoline (others) | CC(C)CN1C=NC2=C1C3=CC=CC=C3N=C2N | NA | Nucleic Acid | Synthetic | It induces inflammatory responses when applied to the skin | Toll-like receptor 7 (TLR7) | Toll-like receptor (TLR) | Mice | NA | Leucine-rich Repeat (LRR) Domain | P58681.fasta | P58681 | 1050 | It leads to the inflammation of the cell | NA | 20739947 | 2010 | Pubchem Assay |
| PRRID_0577 | Imiquimod Click for more detail | imidazoquinoline (others) | CC(C)CN1C=NC2=C1C3=CC=CC=C3N=C2N | NA | imidazoquinolines | Synthetic | It activates the NF- | Toll-like receptor 7 (TLR7) | Toll-like receptor (TLR) | Mice (Murine) | Spleenocytes | Leucine-rich Repeat (LRR) Domain | P58681.fasta | P58681 | 1050 | It leads to the activation of splenocytes and the inhibition of murine B16 melanoma growth and metastasis | NA | 20543857 | 2010 | Pubchem Assay |
| PRRID_0577 | Imiquimod Click for more detail | imidazoquinoline (others) | CC(C)CN1C=NC2=C1C3=CC=CC=C3N=C2N | NA | imidazoquinolines | Synthetic | It activates the NF- | Toll-like receptor 7 (TLR7) | Toll-like receptor (TLR) | Mice (Murine) | Spleenocytes | Leucine-rich Repeat (LRR) Domain | P58681.fasta | P58681 | 1050 | It leads to the activation of splenocytes and the inhibition of murine B16 melanoma growth and metastasis | NA | 20543857 | 2010 | Pubchem Assay |
| PRRID_0580 | IMO-1 Click for more detail | NA | 5'-TCTGToCG2TTGT-X-TGTTG2CoTGTCT-5' | NA | Nucleic Acid | Synthetic | Binding leads to the secretion of cytokines and chemokines such as IL-6, IP-10, IL-12 and MCP-1 | Toll-like receptor 9 (TLR9) | Toll-like receptor (TLR) | Mice | HEK293 cells, Bcells, PDCs, mDCs, PBMC | Leucine-rich Repeat (LRR) Domain | Q9NR96.fasta | Q9NR96 | 1032 | This has immunostimulatory effect | Cytokines assay | 20381019 | 2010 | Pubchem Assay |
| PRRID_0580 | IMO-1 Click for more detail | NA | 5'-TCTGToCG2TTGT-X-TGTTG2CoTGTCT-5' | NA | Nucleic Acid | Synthetic | Binding leads to the secretion of cytokines and chemokines such as IL-6, IP-10, IL-12 and MCP-1 | Toll-like receptor 9 (TLR9) | Toll-like receptor (TLR) | Mice | HEK293 cells, Bcells, PDCs, mDCs, PBMC | Leucine-rich Repeat (LRR) Domain | Q9NR96.fasta | Q9NR96 | 1032 | This has immunostimulatory effect | Cytokines assay | 20381019 | 2010 | Pubchem Assay |
| PRRID_0581 | IMO-10 Click for more detail | NA | 5'-TCG2TCG2TTdUY-M-YdUTTG2CTG2CT-5' | NA | Nucleic Acid | Synthetic | Binding leads to the secretion of cytokines and chemokines such as IL-6, IP-10, IL-12 and MCP-10 | Toll-like receptor 9 (TLR9) | Toll-like receptor (TLR) | Mice | HEK293 cells, Bcells, PDCs, mDCs, PBMC | Leucine-rich Repeat (LRR) Domain | Q9NR96.fasta | Q9NR96 | 1032 | This has immunostimulatory effect | Cytokines assay | 20381019 | 2010 | Pubchem Assay |
| PRRID_0581 | IMO-10 Click for more detail | NA | 5'-TCG2TCG2TTdUY-M-YdUTTG2CTG2CT-5' | NA | Nucleic Acid | Synthetic | Binding leads to the secretion of cytokines and chemokines such as IL-6, IP-10, IL-12 and MCP-10 | Toll-like receptor 9 (TLR9) | Toll-like receptor (TLR) | Mice | HEK293 cells, Bcells, PDCs, mDCs, PBMC | Leucine-rich Repeat (LRR) Domain | Q9NR96.fasta | Q9NR96 | 1032 | This has immunostimulatory effect | Cytokines assay | 20381019 | 2010 | Pubchem Assay |
| PRRID_0582 | IMO-11 Click for more detail | NA | 5'-TCG1TACG1TACG1-X-G1CATG1CATG1CT-5' | NA | Nucleic Acid | Synthetic | Binding leads to the secretion of cytokines and chemokines such as IL-6, IP-10, IL-12 and MCP-11 | Toll-like receptor 9 (TLR9) | Toll-like receptor (TLR) | Mice | HEK293 cells, Bcells, PDCs, mDCs, PBMC | Leucine-rich Repeat (LRR) Domain | Q9NR96.fasta | Q9NR96 | 1032 | This has immunostimulatory effect | Cytokines assay | 20381019 | 2010 | Pubchem Assay |
| PRRID_0582 | IMO-11 Click for more detail | NA | 5'-TCG1TACG1TACG1-X-G1CATG1CATG1CT-5' | NA | Nucleic Acid | Synthetic | Binding leads to the secretion of cytokines and chemokines such as IL-6, IP-10, IL-12 and MCP-11 | Toll-like receptor 9 (TLR9) | Toll-like receptor (TLR) | Mice | HEK293 cells, Bcells, PDCs, mDCs, PBMC | Leucine-rich Repeat (LRR) Domain | Q9NR96.fasta | Q9NR96 | 1032 | This has immunostimulatory effect | Cytokines assay | 20381019 | 2010 | Pubchem Assay |
| PRRID_0583 | IMO-12 Click for more detail | NA | 5'-TCG1AACG1TTCoG-Z-GoCTTG1CAAG1CT-5' | NA | Nucleic Acid | Synthetic | Binding leads to the secretion of cytokines and chemokines such as IL-6, IP-10, IL-12 and MCP-12 | Toll-like receptor 9 (TLR9) | Toll-like receptor (TLR) | Mice | HEK293 cells, Bcells, PDCs, mDCs, PBMC | Leucine-rich Repeat (LRR) Domain | Q9NR96.fasta | Q9NR96 | 1032 | This has immunostimulatory effect | Cytokines assay | 20381019 | 2010 | Pubchem Assay |
| PRRID_0583 | IMO-12 Click for more detail | NA | 5'-TCG1AACG1TTCoG-Z-GoCTTG1CAAG1CT-5' | NA | Nucleic Acid | Synthetic | Binding leads to the secretion of cytokines and chemokines such as IL-6, IP-10, IL-12 and MCP-12 | Toll-like receptor 9 (TLR9) | Toll-like receptor (TLR) | Mice | HEK293 cells, Bcells, PDCs, mDCs, PBMC | Leucine-rich Repeat (LRR) Domain | Q9NR96.fasta | Q9NR96 | 1032 | This has immunostimulatory effect | Cytokines assay | 20381019 | 2010 | Pubchem Assay |
| PRRID_0584 | IMO-13 Click for more detail | NA | 5'-TCG1AACG1TTCG1-L-G1CTTG1CAAG1CT-5' | NA | Nucleic Acid | Synthetic | Binding leads to the secretion of cytokines and chemokines such as IL-6, IP-10, IL-12 and MCP-13 | Toll-like receptor 9 (TLR9) | Toll-like receptor (TLR) | Mice | HEK293 cells, Bcells, PDCs, mDCs, PBMC | Leucine-rich Repeat (LRR) Domain | Q9NR96.fasta | Q9NR96 | 1032 | This has immunostimulatory effect | Cytokines assay | 20381019 | 2010 | Pubchem Assay |
| PRRID_0584 | IMO-13 Click for more detail | NA | 5'-TCG1AACG1TTCG1-L-G1CTTG1CAAG1CT-5' | NA | Nucleic Acid | Synthetic | Binding leads to the secretion of cytokines and chemokines such as IL-6, IP-10, IL-12 and MCP-13 | Toll-like receptor 9 (TLR9) | Toll-like receptor (TLR) | Mice | HEK293 cells, Bcells, PDCs, mDCs, PBMC | Leucine-rich Repeat (LRR) Domain | Q9NR96.fasta | Q9NR96 | 1032 | This has immunostimulatory effect | Cytokines assay | 20381019 | 2010 | Pubchem Assay |
| PRRID_0585 | IMO-14 Click for more detail | NA | 5'-TCG1AACG1ToTCoG-m-GoCToTG1CAAG1CT-5' | NA | Nucleic Acid | Synthetic | Binding leads to the secretion of cytokines and chemokines such as IL-6, IP-10, IL-12 and MCP-14 | Toll-like receptor 9 (TLR9) | Toll-like receptor (TLR) | Mice | HEK293 cells, Bcells, PDCs, mDCs, PBMC | Leucine-rich Repeat (LRR) Domain | Q9NR96.fasta | Q9NR96 | 1032 | This has immunostimulatory effect | Cytokines assay | 20381019 | 2010 | Pubchem Assay |
| PRRID_0585 | IMO-14 Click for more detail | NA | 5'-TCG1AACG1ToTCoG-m-GoCToTG1CAAG1CT-5' | NA | Nucleic Acid | Synthetic | Binding leads to the secretion of cytokines and chemokines such as IL-6, IP-10, IL-12 and MCP-14 | Toll-like receptor 9 (TLR9) | Toll-like receptor (TLR) | Mice | HEK293 cells, Bcells, PDCs, mDCs, PBMC | Leucine-rich Repeat (LRR) Domain | Q9NR96.fasta | Q9NR96 | 1032 | This has immunostimulatory effect | Cytokines assay | 20381019 | 2010 | Pubchem Assay |
| PRRID_0586 | IMO-15 Click for more detail | NA | 5'-TCG1AACG1dUdUCoG-M-GoCdUdUG1CAAG1CT-5' | NA | Nucleic Acid | Synthetic | Binding leads to the secretion of cytokines and chemokines such as IL-6, IP-10, IL-12 and MCP-15 | Toll-like receptor 9 (TLR9) | Toll-like receptor (TLR) | Mice | HEK293 cells, Bcells, PDCs, mDCs, PBMC | Leucine-rich Repeat (LRR) Domain | Q9NR96.fasta | Q9NR96 | 1032 | This has immunostimulatory effect | Cytokines assay | 20381019 | 2010 | Pubchem Assay |
| PRRID_0586 | IMO-15 Click for more detail | NA | 5'-TCG1AACG1dUdUCoG-M-GoCdUdUG1CAAG1CT-5' | NA | Nucleic Acid | Synthetic | Binding leads to the secretion of cytokines and chemokines such as IL-6, IP-10, IL-12 and MCP-15 | Toll-like receptor 9 (TLR9) | Toll-like receptor (TLR) | Mice | HEK293 cells, Bcells, PDCs, mDCs, PBMC | Leucine-rich Repeat (LRR) Domain | Q9NR96.fasta | Q9NR96 | 1032 | This has immunostimulatory effect | Cytokines assay | 20381019 | 2010 | Pubchem Assay |
| PRRID_0587 | IMO-16 Click for more detail | NA | 5'-ACACACCAACT-X-TCAACCACACA-5' | NA | Nucleic Acid | Synthetic | Binding leads to the secretion of cytokines and chemokines such as IL-6, IP-10, IL-12 and MCP-16 | Toll-like receptor 9 (TLR9) | Toll-like receptor (TLR) | Mice | HEK293 cells, Bcells, PDCs, mDCs, PBMC | Leucine-rich Repeat (LRR) Domain | Q9NR96.fasta | Q9NR96 | 1032 | This has immunostimulatory effect | Cytokines assay | 20381019 | 2010 | Pubchem Assay |
| PRRID_0587 | IMO-16 Click for more detail | NA | 5'-ACACACCAACT-X-TCAACCACACA-5' | NA | Nucleic Acid | Synthetic | Binding leads to the secretion of cytokines and chemokines such as IL-6, IP-10, IL-12 and MCP-16 | Toll-like receptor 9 (TLR9) | Toll-like receptor (TLR) | Mice | HEK293 cells, Bcells, PDCs, mDCs, PBMC | Leucine-rich Repeat (LRR) Domain | Q9NR96.fasta | Q9NR96 | 1032 | This has immunostimulatory effect | Cytokines assay | 20381019 | 2010 | Pubchem Assay |
| PRRID_0588 | IMO-2 Click for more detail | NA | 5'-TCTGTCG2TTCU-X-UCTTG2CTGTCT-5' | NA | Nucleic Acid | Synthetic | Binding leads to the secretion of cytokines and chemokines such as IL-6, IP-10, IL-12 and MCP-2 | Toll-like receptor 9 (TLR9) | Toll-like receptor (TLR) | Mice | HEK293 cells, Bcells, PDCs, mDCs, PBMC | Leucine-rich Repeat (LRR) Domain | Q9NR96.fasta | Q9NR96 | 1032 | This has immunostimulatory effect | Cytokines assay | 20381019 | 2010 | Pubchem Assay |
| PRRID_0588 | IMO-2 Click for more detail | NA | 5'-TCTGTCG2TTCU-X-UCTTG2CTGTCT-5' | NA | Nucleic Acid | Synthetic | Binding leads to the secretion of cytokines and chemokines such as IL-6, IP-10, IL-12 and MCP-2 | Toll-like receptor 9 (TLR9) | Toll-like receptor (TLR) | Mice | HEK293 cells, Bcells, PDCs, mDCs, PBMC | Leucine-rich Repeat (LRR) Domain | Q9NR96.fasta | Q9NR96 | 1032 | This has immunostimulatory effect | Cytokines assay | 20381019 | 2010 | Pubchem Assay |
| PRRID_0589 | IMO-3 Click for more detail | NA | 5'-TCAGToCG2TTAC-Z-CATTG2CoTGACT-5' | NA | Nucleic Acid | Synthetic | Binding leads to the secretion of cytokines and chemokines such as IL-6, IP-10, IL-12 and MCP-3 | Toll-like receptor 9 (TLR9) | Toll-like receptor (TLR) | Mice | HEK293 cells, Bcells, PDCs, mDCs, PBMC | Leucine-rich Repeat (LRR) Domain | Q9NR96.fasta | Q9NR96 | 1032 | This has immunostimulatory effect | Cytokines assay | 20381019 | 2010 | Pubchem Assay |
| PRRID_0589 | IMO-3 Click for more detail | NA | 5'-TCAGToCG2TTAC-Z-CATTG2CoTGACT-5' | NA | Nucleic Acid | Synthetic | Binding leads to the secretion of cytokines and chemokines such as IL-6, IP-10, IL-12 and MCP-3 | Toll-like receptor 9 (TLR9) | Toll-like receptor (TLR) | Mice | HEK293 cells, Bcells, PDCs, mDCs, PBMC | Leucine-rich Repeat (LRR) Domain | Q9NR96.fasta | Q9NR96 | 1032 | This has immunostimulatory effect | Cytokines assay | 20381019 | 2010 | Pubchem Assay |
| PRRID_0590 | IMO-4 Click for more detail | NA | 5'-TCTGoToCG2TTAG-M-GATTG2CoToGTCT-5' | NA | Nucleic Acid | Synthetic | Binding leads to the secretion of cytokines and chemokines such as IL-6, IP-10, IL-12 and MCP-4 | Toll-like receptor 9 (TLR9) | Toll-like receptor (TLR) | Mice | HEK293 cells, Bcells, PDCs, mDCs, PBMC | Leucine-rich Repeat (LRR) Domain | Q9NR96.fasta | Q9NR96 | 1032 | This has immunostimulatory effect | Cytokines assay | 20381019 | 2010 | Pubchem Assay |
| PRRID_0590 | IMO-4 Click for more detail | NA | 5'-TCTGoToCG2TTAG-M-GATTG2CoToGTCT-5' | NA | Nucleic Acid | Synthetic | Binding leads to the secretion of cytokines and chemokines such as IL-6, IP-10, IL-12 and MCP-4 | Toll-like receptor 9 (TLR9) | Toll-like receptor (TLR) | Mice | HEK293 cells, Bcells, PDCs, mDCs, PBMC | Leucine-rich Repeat (LRR) Domain | Q9NR96.fasta | Q9NR96 | 1032 | This has immunostimulatory effect | Cytokines assay | 20381019 | 2010 | Pubchem Assay |
| PRRID_0591 | IMO-5 Click for more detail | NA | 5'-CAGTCoG2TTCAG-Z-GACTTG2oCTGAC-5' | NA | Nucleic Acid | Synthetic | Binding leads to the secretion of cytokines and chemokines such as IL-6, IP-10, IL-12 and MCP-5 | Toll-like receptor 9 (TLR9) | Toll-like receptor (TLR) | Mice | HEK293 cells, Bcells, PDCs, mDCs, PBMC | Leucine-rich Repeat (LRR) Domain | Q9NR96.fasta | Q9NR96 | 1032 | This has immunostimulatory effect | Cytokines assay | 20381019 | 2010 | Pubchem Assay |
| PRRID_0591 | IMO-5 Click for more detail | NA | 5'-CAGTCoG2TTCAG-Z-GACTTG2oCTGAC-5' | NA | Nucleic Acid | Synthetic | Binding leads to the secretion of cytokines and chemokines such as IL-6, IP-10, IL-12 and MCP-5 | Toll-like receptor 9 (TLR9) | Toll-like receptor (TLR) | Mice | HEK293 cells, Bcells, PDCs, mDCs, PBMC | Leucine-rich Repeat (LRR) Domain | Q9NR96.fasta | Q9NR96 | 1032 | This has immunostimulatory effect | Cytokines assay | 20381019 | 2010 | Pubchem Assay |
| PRRID_0592 | IMO-6 Click for more detail | NA | 5'-TCG1TCG1TTTY-M-YTTTG1CTG1CT-5' | NA | Nucleic Acid | Synthetic | Binding leads to the secretion of cytokines and chemokines such as IL-6, IP-10, IL-12 and MCP-6 | Toll-like receptor 9 (TLR9) | Toll-like receptor (TLR) | Mice | HEK293 cells, Bcells, PDCs, mDCs, PBMC | Leucine-rich Repeat (LRR) Domain | Q9NR96.fasta | Q9NR96 | 1032 | This has immunostimulatory effect | Cytokines assay | 20381019 | 2010 | Pubchem Assay |
| PRRID_0592 | IMO-6 Click for more detail | NA | 5'-TCG1TCG1TTTY-M-YTTTG1CTG1CT-5' | NA | Nucleic Acid | Synthetic | Binding leads to the secretion of cytokines and chemokines such as IL-6, IP-10, IL-12 and MCP-6 | Toll-like receptor 9 (TLR9) | Toll-like receptor (TLR) | Mice | HEK293 cells, Bcells, PDCs, mDCs, PBMC | Leucine-rich Repeat (LRR) Domain | Q9NR96.fasta | Q9NR96 | 1032 | This has immunostimulatory effect | Cytokines assay | 20381019 | 2010 | Pubchem Assay |
| PRRID_0593 | IMO-7 Click for more detail | NA | 5'-TCG1TCG1TTTY-X-YTTTG1CTG1CT-5' | NA | Nucleic Acid | Synthetic | Binding leads to the secretion of cytokines and chemokines such as IL-6, IP-10, IL-12 and MCP-7 | Toll-like receptor 9 (TLR9) | Toll-like receptor (TLR) | Mice | HEK293 cells, Bcells, PDCs, mDCs, PBMC | Leucine-rich Repeat (LRR) Domain | Q9NR96.fasta | Q9NR96 | 1032 | This has immunostimulatory effect | Cytokines assay | 20381019 | 2010 | Pubchem Assay |
| PRRID_0593 | IMO-7 Click for more detail | NA | 5'-TCG1TCG1TTTY-X-YTTTG1CTG1CT-5' | NA | Nucleic Acid | Synthetic | Binding leads to the secretion of cytokines and chemokines such as IL-6, IP-10, IL-12 and MCP-7 | Toll-like receptor 9 (TLR9) | Toll-like receptor (TLR) | Mice | HEK293 cells, Bcells, PDCs, mDCs, PBMC | Leucine-rich Repeat (LRR) Domain | Q9NR96.fasta | Q9NR96 | 1032 | This has immunostimulatory effect | Cytokines assay | 20381019 | 2010 | Pubchem Assay |
| PRRID_0594 | IMO-8 Click for more detail | NA | 5'-TCG1TCG1TTTUU-X-UUTTTG1CTG1CT-5' | NA | Nucleic Acid | Synthetic | Binding leads to the secretion of cytokines and chemokines such as IL-6, IP-10, IL-12 and MCP-8 | Toll-like receptor 9 (TLR9) | Toll-like receptor (TLR) | Mice | HEK293 cells, Bcells, PDCs, mDCs, PBMC | Leucine-rich Repeat (LRR) Domain | Q9NR96.fasta | Q9NR96 | 1032 | This has immunostimulatory effect | Cytokines assay | 20381019 | 2010 | Pubchem Assay |
| PRRID_0594 | IMO-8 Click for more detail | NA | 5'-TCG1TCG1TTTUU-X-UUTTTG1CTG1CT-5' | NA | Nucleic Acid | Synthetic | Binding leads to the secretion of cytokines and chemokines such as IL-6, IP-10, IL-12 and MCP-8 | Toll-like receptor 9 (TLR9) | Toll-like receptor (TLR) | Mice | HEK293 cells, Bcells, PDCs, mDCs, PBMC | Leucine-rich Repeat (LRR) Domain | Q9NR96.fasta | Q9NR96 | 1032 | This has immunostimulatory effect | Cytokines assay | 20381019 | 2010 | Pubchem Assay |
| PRRID_0595 | IMO-9 Click for more detail | NA | 5'-TCG1TCG1TTdUY-Z-YdUTTG1CTG1CT-5' | NA | Nucleic Acid | Synthetic | Binding leads to the secretion of cytokines and chemokines such as IL-6, IP-10, IL-12 and MCP-9 | Toll-like receptor 9 (TLR9) | Toll-like receptor (TLR) | Mice | HEK293 cells, Bcells, PDCs, mDCs, PBMC | Leucine-rich Repeat (LRR) Domain | Q9NR96.fasta | Q9NR96 | 1032 | This has immunostimulatory effect | Cytokines assay | 20381019 | 2010 | Pubchem Assay |
| PRRID_0595 | IMO-9 Click for more detail | NA | 5'-TCG1TCG1TTdUY-Z-YdUTTG1CTG1CT-5' | NA | Nucleic Acid | Synthetic | Binding leads to the secretion of cytokines and chemokines such as IL-6, IP-10, IL-12 and MCP-9 | Toll-like receptor 9 (TLR9) | Toll-like receptor (TLR) | Mice | HEK293 cells, Bcells, PDCs, mDCs, PBMC | Leucine-rich Repeat (LRR) Domain | Q9NR96.fasta | Q9NR96 | 1032 | This has immunostimulatory effect | Cytokines assay | 20381019 | 2010 | Pubchem Assay |
| PRRID_0599 | Korean mistletoe lectin (KML-C) Click for more detail | Korean mistletoe (Viscum album coloratum) (plant) | NA | NA | Lectin | Natural | Binding leads to the upregulation of interleukin-1 receptor-associated kinase-1 (IRAK1), resulting in macrophage activation and TNF-a production. | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Mice | Macropahges | Leucine-rich Repeat (LRR) Domain | Q9QUK6.fasta | Q9QUK6 | 835 | KML-C has strong immunomodulatory effects, such as immune cell activation and cytokine induction, which results in antitumor activities or protection from microbial infections. | ELISA | 20450885 | 2010 | Pubchem Assay |
| PRRID_0599 | Korean mistletoe lectin (KML-C) Click for more detail | Korean mistletoe (Viscum album coloratum) (plant) | NA | NA | Lectin | Natural | Binding leads to the upregulation of interleukin-1 receptor-associated kinase-1 (IRAK1), resulting in macrophage activation and TNF-a production. | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Mice | Macropahges | Leucine-rich Repeat (LRR) Domain | Q9QUK6.fasta | Q9QUK6 | 835 | KML-C has strong immunomodulatory effects, such as immune cell activation and cytokine induction, which results in antitumor activities or protection from microbial infections. | ELISA | 20450885 | 2010 | Pubchem Assay |
| PRRID_0601 | LAM Click for more detail | Mycobacteria (Bacteria) | OC[C@H]1O[C@@H](S[C@H]2[C@H](O)[C@@H](CO)O[C@@H](O[C@@H]3[C@H](O)[C@@H](CO)O[C@H](Oc4ccc(cc4)[N+]([O-])=O)[C@@H]3O)[C@@H]2O)[C@H](O)[C@@H](O)[C@@H]1O | NA | Pattern-associated molecular patterns (PAMPs) | Natural | Increases expression of macrophage inflammatory protein-2 , cytokine migration inhibitory factor (MIF), and TNF-α and induces augment PMN migration. | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Mice | Lung's endothelial cell | Leucine-rich Repeat (LRR) Domain | Q9QUN7.fasta | Q9QUN7 | 784 | It has the role in the inflammation. | NA | 20706658 | 2010 | Pubchem Assay |
| PRRID_0601 | LAM Click for more detail | Mycobacteria (Bacteria) | OC[C@H]1O[C@@H](S[C@H]2[C@H](O)[C@@H](CO)O[C@@H](O[C@@H]3[C@H](O)[C@@H](CO)O[C@H](Oc4ccc(cc4)[N+]([O-])=O)[C@@H]3O)[C@@H]2O)[C@H](O)[C@@H](O)[C@@H]1O | NA | Pattern-associated molecular patterns (PAMPs) | Natural | Increases expression of macrophage inflammatory protein-2 , cytokine migration inhibitory factor (MIF), and TNF-α and induces augment PMN migration. | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Mice | Lung's endothelial cell | Leucine-rich Repeat (LRR) Domain | Q9QUN7.fasta | Q9QUN7 | 784 | It has the role in the inflammation. | NA | 20706658 | 2010 | Pubchem Assay |
| PRRID_0602 | lentinan Click for more detail | Lentinus edodes (fungi) | C(C1C(C(C(C(O1)OCC2C(C(C(C(O2)O)O)OC3C(C(C(C(O3)CO)O)OC4C(C(C(C(O4)CO)O)OC5C(C(C(C(O5)COC6C(C(C(C(O6)CO)O)O)O)O)OC7C(C(C(C(O7)CO)O)O)O)O)O)O)O)O)O)O)O | NA | Biological response modifiers (BRMs) | Natural | Medicinal properties | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Mice | dendritic cells and macrophages | Leucine-rich Repeat (LRR) Domain | Q9QUK6.fasta | Q9QUK6 | 835 | used clinically for cancer therapy | NA | 20699131 | 2010 | Pubchem Assay |
| PRRID_0602 | lentinan Click for more detail | Lentinus edodes (fungi) | C(C1C(C(C(C(O1)OCC2C(C(C(C(O2)O)O)OC3C(C(C(C(O3)CO)O)OC4C(C(C(C(O4)CO)O)OC5C(C(C(C(O5)COC6C(C(C(C(O6)CO)O)O)O)O)OC7C(C(C(C(O7)CO)O)O)O)O)O)O)O)O)O)O)O | NA | Biological response modifiers (BRMs) | Natural | Medicinal properties | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Mice | dendritic cells and macrophages | Leucine-rich Repeat (LRR) Domain | Q9QUK6.fasta | Q9QUK6 | 835 | used clinically for cancer therapy | NA | 20699131 | 2010 | Pubchem Assay |
| PRRID_0603 | lethal toxin (LeTx) Click for more detail | Bacillus anthracis(Bacteria) | NA | NA | toxin | Natural | It’s binding to the IPAF leads to the activation of caspase-1 via ASC adaptor protein | Nod-like receptor protein 1 (NLRP1) | NOD-like receptor (NLR) | Mice | Macropahges | NA | Q2LKU9.fasta | Q2LKU9 | 1182 | It activates the inflammasome via NLRP1 | NA | 20303873 | 2010 | Pubchem Assay |
| PRRID_0603 | lethal toxin (LeTx) Click for more detail | Bacillus anthracis(Bacteria) | NA | NA | toxin | Natural | It’s binding to the IPAF leads to the activation of caspase-1 via ASC adaptor protein | Nod-like receptor protein 1 (NLRP1) | NOD-like receptor (NLR) | Mice | Macropahges | NA | Q2LKU9.fasta | Q2LKU9 | 1182 | It activates the inflammasome via NLRP1 | NA | 20303873 | 2010 | Pubchem Assay |
| PRRID_0608 | Lipopolysaccharide (LPS) Click for more detail | Bacteria | CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC | NA | Lipopolysaccharide (LPS) | Natural | K63-linked ubiquitination of Beclin1 using TRAF6 and A20 and triggered autophagy | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Mice (Murine) | Plasma Membrane | Leucine-rich Repeat (LRR) Domain | Q9QUK6.fasta | Q9QUK6 | 835 | It leads to autophagy and hence clearance of the pathogen | NA | 20798608 | 2010 | Pubchem Assay |
| PRRID_0608 | Lipopolysaccharide (LPS) Click for more detail | Bacteria | CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC | NA | Lipopolysaccharide (LPS) | Natural | K63-linked ubiquitination of Beclin1 using TRAF6 and A20 and triggered autophagy | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Mice (Murine) | Plasma Membrane | Leucine-rich Repeat (LRR) Domain | Q9QUK6.fasta | Q9QUK6 | 835 | It leads to autophagy and hence clearance of the pathogen | NA | 20798608 | 2010 | Pubchem Assay |
| PRRID_0614 | Lipopolysaccharide (LPS) Click for more detail | S. aureus (Bacteria) | CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC | NA | Lipopolysaccharide (LPS) | Natural | Lipopolysaccharides are the potent activators of TLR4 | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | C57BL/6 Mice | Macropahges | Leucine-rich Repeat (LRR) Domain | Q9QUK6.fasta | Q9QUK6 | 835 | Contributes to inflammatory responses induced by orthopaedic wear particles in cell culture and murine models of aseptic loosening of orthopaedic implants | NA | 20729214 | 2010 | Pubchem Assay |
| PRRID_0614 | Lipopolysaccharide (LPS) Click for more detail | S. aureus (Bacteria) | CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC | NA | Lipopolysaccharide (LPS) | Natural | Lipopolysaccharides are the potent activators of TLR4 | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | C57BL/6 Mice | Macropahges | Leucine-rich Repeat (LRR) Domain | Q9QUK6.fasta | Q9QUK6 | 835 | Contributes to inflammatory responses induced by orthopaedic wear particles in cell culture and murine models of aseptic loosening of orthopaedic implants | NA | 20729214 | 2010 | Pubchem Assay |
| PRRID_0616 | Lipopolysaccharide (LPS) Click for more detail | Escherichia coli O111: B4 (Bacteria) | CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC | NA | Lipopolysaccharide (LPS) | Natural | BCAP-L is a negative regulator of TLR signaling-induced production of IL-6 and IL10 but not TNF-a in macrophages | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Mice | macrophages | Leucine-rich Repeat (LRR) Domain | Q9QUK6.fasta | Q9QUK6 | 835 | It has the role in the inflammation. | NA | 20728433 | 2010 | Pubchem Assay |
| PRRID_0616 | Lipopolysaccharide (LPS) Click for more detail | Escherichia coli O111: B4 (Bacteria) | CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC | NA | Lipopolysaccharide (LPS) | Natural | BCAP-L is a negative regulator of TLR signaling-induced production of IL-6 and IL10 but not TNF-a in macrophages | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Mice | macrophages | Leucine-rich Repeat (LRR) Domain | Q9QUK6.fasta | Q9QUK6 | 835 | It has the role in the inflammation. | NA | 20728433 | 2010 | Pubchem Assay |
| PRRID_0621 | Lipopolysaccharide (LPS) Click for more detail | Gram-negative bacteria | CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC | NA | Lipopolysaccharide (LPS) | Natural | induces a signaling cascade that utilizes both the MyD88- and TRIF-dependent pathways, leading to NF-kB and IRF3/7 activation | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Mice (Murine) | dendritic cells and macrophages | Leucine-rich Repeat (LRR) Domain | Q9QUK6.fasta | Q9QUK6 | 835 | It has the role in the inflammation. | NA | 20713100 | 2010 | Pubchem Assay |
| PRRID_0621 | Lipopolysaccharide (LPS) Click for more detail | Gram-negative bacteria | CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC | NA | Lipopolysaccharide (LPS) | Natural | induces a signaling cascade that utilizes both the MyD88- and TRIF-dependent pathways, leading to NF-kB and IRF3/7 activation | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Mice (Murine) | dendritic cells and macrophages | Leucine-rich Repeat (LRR) Domain | Q9QUK6.fasta | Q9QUK6 | 835 | It has the role in the inflammation. | NA | 20713100 | 2010 | Pubchem Assay |
| PRRID_0624 | Lipopolysaccharide (LPS) Click for more detail | Gram-negative bacteria | CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC | NA | Lipopolysaccharide (LPS) | Natural | It produces a large amount of glutamate, an important neurotransmitter but also a potent neurotoxin and is linked to oligodendrocyte injury | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Mice | Microglia | Leucine-rich Repeat (LRR) Domain | Q9QUK6.fasta | Q9QUK6 | 835 | produce a large amount of glutamate, an important neurotransmitter but also a potent neurotoxin and is linked to oligodendrocyte injury | NA | 20706642 | 2010 | Pubchem Assay |
| PRRID_0624 | Lipopolysaccharide (LPS) Click for more detail | Gram-negative bacteria | CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC | NA | Lipopolysaccharide (LPS) | Natural | It produces a large amount of glutamate, an important neurotransmitter but also a potent neurotoxin and is linked to oligodendrocyte injury | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Mice | Microglia | Leucine-rich Repeat (LRR) Domain | Q9QUK6.fasta | Q9QUK6 | 835 | produce a large amount of glutamate, an important neurotransmitter but also a potent neurotoxin and is linked to oligodendrocyte injury | NA | 20706642 | 2010 | Pubchem Assay |
| PRRID_0628 | Lipopolysaccharide (LPS) Click for more detail | Bacteria | CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC | NA | Lipopolysaccharide (LPS) | Natural | NA | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | AD Mice's hippocampus | microglia | Leucine-rich Repeat (LRR) Domain | Q9QUK6.fasta | Q9QUK6 | 835 | Involved in the clearance of Aβ deposits in the brain | NA | 20706642 | 2010 | Pubchem Assay |
| PRRID_0628 | Lipopolysaccharide (LPS) Click for more detail | Bacteria | CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC | NA | Lipopolysaccharide (LPS) | Natural | NA | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | AD Mice's hippocampus | microglia | Leucine-rich Repeat (LRR) Domain | Q9QUK6.fasta | Q9QUK6 | 835 | Involved in the clearance of Aβ deposits in the brain | NA | 20706642 | 2010 | Pubchem Assay |
| PRRID_0630 | Lipopolysaccharide (LPS) Click for more detail | Gram-negative bacteria | CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC | NA | Lipopolysaccharide (LPS) | Natural | NA | I-ankyrin-repeats | ankyrin-repeats | Mice | small intestine, trachea, cornea, and conjunctiva, liver and kidney tissue | NA | NA | NA | NA | suppress the production of proinflammatory cytokines | NA | 20703156 | 2010 | NA |
| PRRID_0630 | Lipopolysaccharide (LPS) Click for more detail | Gram-negative bacteria | CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC | NA | Lipopolysaccharide (LPS) | Natural | NA | I-ankyrin-repeats | ankyrin-repeats | Mice | small intestine, trachea, cornea, and conjunctiva, liver and kidney tissue | NA | NA | NA | NA | suppress the production of proinflammatory cytokines | NA | 20703156 | 2010 | NA |
| PRRID_0644 | Lipopolysaccharide (LPS) Click for more detail | Escherichia coli strain 0111:B4 (Bacteria) | CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC | NA | Lipopolysaccharide (LPS) | Natural | It induces the release of microparticles by the macrophages | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Mice (Murine) | Macropahes | LRR | Q9QUK6.fasta | Q9QUK6 | 835 | It leads to the release of MPs which act as the novel signals for innate immunity | Griess assay | 20335312 | 2010 | Pubchem Assay |
| PRRID_0644 | Lipopolysaccharide (LPS) Click for more detail | Escherichia coli strain 0111:B4 (Bacteria) | CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC | NA | Lipopolysaccharide (LPS) | Natural | It induces the release of microparticles by the macrophages | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Mice (Murine) | Macropahes | LRR | Q9QUK6.fasta | Q9QUK6 | 835 | It leads to the release of MPs which act as the novel signals for innate immunity | Griess assay | 20335312 | 2010 | Pubchem Assay |
| PRRID_0650 | Peptidoglycan (PGN) Click for more detail | S. aureus (Bacteria) | CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N | NA | Peptidoglycan | Natural | Their binding to the TLR2 leads to the activation of the downstream signalling | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | C57/BL Mice cell line | NA | Leucine-rich Repeat (LRR) Domain | O53505.fasta | O53505 | 227 | maturation of the Dendritic cells | NA | 20795386 | 2010 | Pubchem Assay |
| PRRID_0650 | Peptidoglycan (PGN) Click for more detail | S. aureus (Bacteria) | CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N | NA | Peptidoglycan | Natural | Their binding to the TLR2 leads to the activation of the downstream signalling | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | C57/BL Mice cell line | NA | Leucine-rich Repeat (LRR) Domain | O53505.fasta | O53505 | 227 | maturation of the Dendritic cells | NA | 20795386 | 2010 | Pubchem Assay |
| PRRID_0653 | Lipoteichoic Acid (LTA) Click for more detail | E. coli(Bacteria) | C(C1C(C(C(C(O1)OCC(CO)O)OC2C(C(C(C(O2)COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(CO)O)O)O)O)O)O)O)O)O)O | NA | Amphiphile | Natural | Peptidoglycan is the potent activator of the TLR2 | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | C57BL/6 Mice | NA | Leucine-rich Repeat (LRR) Domain | Q9QUN7.fasta | Q9QUN7 | 784 | Contributes to inflammatory responses induced by orthopaedic wear particles in cell culture and murine models of aseptic loosening of orthopaedic implants | NA | 20729214 | 2010 | Pubchem Assay |
| PRRID_0653 | Lipoteichoic Acid (LTA) Click for more detail | E. coli(Bacteria) | C(C1C(C(C(C(O1)OCC(CO)O)OC2C(C(C(C(O2)COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(CO)O)O)O)O)O)O)O)O)O)O | NA | Amphiphile | Natural | Peptidoglycan is the potent activator of the TLR2 | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | C57BL/6 Mice | NA | Leucine-rich Repeat (LRR) Domain | Q9QUN7.fasta | Q9QUN7 | 784 | Contributes to inflammatory responses induced by orthopaedic wear particles in cell culture and murine models of aseptic loosening of orthopaedic implants | NA | 20729214 | 2010 | Pubchem Assay |
| PRRID_0660 | Low Molecular Weight Hyaluronic Acid (LMW-HA) Click for more detail | human umbilical cord (others) | CC(=O)NC1CC(C(OC1OC2C(C(C(OC2C(=O)[O-])O)O)O)CO)O | NA | Endogenous | Synthetic | Binding of the ligand leads to Akt phosphorylation and activation of the transcription factor NF-κB which results in secretion of proinflammatory cytokines | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Mice | embryonic mouse telencephalon and NPC | Leucine-rich Repeat (LRR) Domain | Q9QUN7.fasta | Q9QUN7 | 784 | its activation inhibits NPC proliferation and decreases cell proliferation. | NA | 20456021 | 2010 | Pubchem Assay |
| PRRID_0660 | Low Molecular Weight Hyaluronic Acid (LMW-HA) Click for more detail | human umbilical cord (others) | CC(=O)NC1CC(C(OC1OC2C(C(C(OC2C(=O)[O-])O)O)O)CO)O | NA | Endogenous | Synthetic | Binding of the ligand leads to Akt phosphorylation and activation of the transcription factor NF-κB which results in secretion of proinflammatory cytokines | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Mice | embryonic mouse telencephalon and NPC | Leucine-rich Repeat (LRR) Domain | Q9QUN7.fasta | Q9QUN7 | 784 | its activation inhibits NPC proliferation and decreases cell proliferation. | NA | 20456021 | 2010 | Pubchem Assay |
| PRRID_0671 | Mannan Click for more detail | Candida albicans(fungi) | CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC | NA | Polysaccharides | Natural | NA | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Mice (Murine) | dendritic cells and macrophages | Leucine-rich Repeat (LRR) Domain | Q9QUK6.fasta | Q9QUK6 | 835 | NA | NA | 20713100 | 2010 | Pubchem Assay |
| PRRID_0671 | Mannan Click for more detail | Candida albicans(fungi) | CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC | NA | Polysaccharides | Natural | NA | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Mice (Murine) | dendritic cells and macrophages | Leucine-rich Repeat (LRR) Domain | Q9QUK6.fasta | Q9QUK6 | 835 | NA | NA | 20713100 | 2010 | Pubchem Assay |
| PRRID_0676 | mannose, fucose and N-acetylglucosamine residues Click for more detail | Endogenous (others) | C(C1C(C(C(C(O1)O)O)O)O)O, CC(C(C(C(C=O)O)O)O)O, CC(=O)NC1C(C(C(OC1O)CO)O)O | NA | Damage-associated molecular patterns (DAMPs) | Natural | These ligands binds to MR in calcium-dependent fashion, leads to the secretion of proinflammatory molecules, resulted in inflammation | Mannose receptor | Mannose receptor (MR) | Mice (Murine) | macrophages, certain dendritic cells, endothelial cell and mesangial cells | NA | Q61830.fasta | Q61830 | 1456 | It helps in clearing endogenous ligands released in the inflammatory response including lysosomal hydrolases, tissue plasminogen activator and myeloperoxidase and also has tissue protection during inflammation | NA | 20650906 | 2010 | Pubchem Assay |
| PRRID_0676 | mannose, fucose and N-acetylglucosamine residues Click for more detail | Endogenous (others) | C(C1C(C(C(C(O1)O)O)O)O)O, CC(C(C(C(C=O)O)O)O)O, CC(=O)NC1C(C(C(OC1O)CO)O)O | NA | Damage-associated molecular patterns (DAMPs) | Natural | These ligands binds to MR in calcium-dependent fashion, leads to the secretion of proinflammatory molecules, resulted in inflammation | Mannose receptor | Mannose receptor (MR) | Mice (Murine) | macrophages, certain dendritic cells, endothelial cell and mesangial cells | NA | Q61830.fasta | Q61830 | 1456 | It helps in clearing endogenous ligands released in the inflammatory response including lysosomal hydrolases, tissue plasminogen activator and myeloperoxidase and also has tissue protection during inflammation | NA | 20650906 | 2010 | Pubchem Assay |
| PRRID_0684 | MOMP Click for more detail | Shigella flexneri (Bacteria) | NA | NA | Protein | Natural | It stimulates macrophages, up regulates the surface expression of MHC-II and B7-1 and enhances the production of different cytokines (such as ILp70, TNF-⍺, Il-6) and chemokines (like MIP-1⍺, MIP-1β and RANTES) | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Mice | Macropahes | LRR | Q9QUN7.fasta | Q9QUN7 | 784 | It initiates event in the antibacterial host response. | ELISA | 20347487 | 2010 | Pubchem Assay |
| PRRID_0684 | MOMP Click for more detail | Shigella flexneri (Bacteria) | NA | NA | Protein | Natural | It stimulates macrophages, up regulates the surface expression of MHC-II and B7-1 and enhances the production of different cytokines (such as ILp70, TNF-⍺, Il-6) and chemokines (like MIP-1⍺, MIP-1β and RANTES) | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Mice | Macropahes | LRR | Q9QUN7.fasta | Q9QUN7 | 784 | It initiates event in the antibacterial host response. | ELISA | 20347487 | 2010 | Pubchem Assay |
| PRRID_0689 | Mrp14 Click for more detail | Mice (others) | MIENYWTSFCGNHHTSSNCTVRFLQICFGITLSFLTLCICLFHKEPPKRIHQFFCLRLVSALFNGIIGSLDLVLGIWVLRENHSKPLILWLVILIQGFTWLFINLIICVRGTRIRKSSLRLLSIFSFFYGLVSSCLSVNNAVFGDELAVRTILDVLLLPGSVLLLLSAYKGYRFDESGESSLYEPLNAGDSNGFSEKADFDNRVSQFAKAGLFSTLSFWWLNSLIKRGNVKDLEEDDIPELRKEERAETCYSLFEENLIEQKRRLGSSCQPSILKVTVLCVWRELLTSGFFAFMKIVAVSAGPLLLNAFILVAEGNASFRYEGLVLAVLLFFSKMIESLSQRQWYFRCRIVGLRVRSLLTAAINKKQLRLNNSSRLIHSGSEIMNYATVDAYRIGEFPYWFHQLWTTSFQLLIALGILFHSVGVATFSALAVIILTVLCNAPIAKLQNKFQSELMTSQDERLKACNESLVNMKVLKLYAWESHFKKVIEKLRNIELKSLKAVQMRKAYNAVLFWSSPVFVSAATFATCYFLDIPLRASNVFTFVATLRLVQDPVRMIPDVIGVTIQAKVAFSRIATFLEAPELQGGERRRKQRSEGNQNAIIIKSASFSWEEKGSTKPNLRNVRLEVKFGEKVAVCGEVGSGKSTLLAAILGETPCVSGTIDFYGTIAYVSQTAWIQTGTIRDNILFGGVMDEHRYRETIQKSSLDKDLELLPDGDQTEIGERGVNLSGGQKQRIQLARALYQDADIYLLDDPFSAVDAHTASSLFQEYVMDALAGKAVLLVTHQVDFLPAFDSVLLMSDGEITEADTYQELLARSRDFQDLVNAHRETAGSERVVAVENPTKPVKEINRVISSQSKVLKPSRLIKQEEREKGDTGLRPYIQYMNQNKGYIFFFIASLAQVTFAVGQILQNSWMAANVDNPQVSTLKLILVYLLIGLCSVLCLMVRSVCVVIMCMKSSASLFSQLLNSLFRAPMSFYDSTPLGRILSRVSSDLSIVDLDV | 1453 | Damage-associated molecular patterns (DAMPs) | Natural | Binding leads to the secretion of the IL-18 | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Mice | Leukocytes and endothelial cells | Leucine-rich Repeat (LRR) Domain | Q9QUK6.fasta | Q9QUK6 | 835 | It promotes the inflammation and might be involved in the progression of inflammation during CD40L-induced autoimmunity. It is also crucial for the devlopment of CD8+ T cells | ELISA | 20473308 | 2010 | Pubchem Assay |
| PRRID_0689 | Mrp14 Click for more detail | Mice (others) | MIENYWTSFCGNHHTSSNCTVRFLQICFGITLSFLTLCICLFHKEPPKRIHQFFCLRLVSALFNGIIGSLDLVLGIWVLRENHSKPLILWLVILIQGFTWLFINLIICVRGTRIRKSSLRLLSIFSFFYGLVSSCLSVNNAVFGDELAVRTILDVLLLPGSVLLLLSAYKGYRFDESGESSLYEPLNAGDSNGFSEKADFDNRVSQFAKAGLFSTLSFWWLNSLIKRGNVKDLEEDDIPELRKEERAETCYSLFEENLIEQKRRLGSSCQPSILKVTVLCVWRELLTSGFFAFMKIVAVSAGPLLLNAFILVAEGNASFRYEGLVLAVLLFFSKMIESLSQRQWYFRCRIVGLRVRSLLTAAINKKQLRLNNSSRLIHSGSEIMNYATVDAYRIGEFPYWFHQLWTTSFQLLIALGILFHSVGVATFSALAVIILTVLCNAPIAKLQNKFQSELMTSQDERLKACNESLVNMKVLKLYAWESHFKKVIEKLRNIELKSLKAVQMRKAYNAVLFWSSPVFVSAATFATCYFLDIPLRASNVFTFVATLRLVQDPVRMIPDVIGVTIQAKVAFSRIATFLEAPELQGGERRRKQRSEGNQNAIIIKSASFSWEEKGSTKPNLRNVRLEVKFGEKVAVCGEVGSGKSTLLAAILGETPCVSGTIDFYGTIAYVSQTAWIQTGTIRDNILFGGVMDEHRYRETIQKSSLDKDLELLPDGDQTEIGERGVNLSGGQKQRIQLARALYQDADIYLLDDPFSAVDAHTASSLFQEYVMDALAGKAVLLVTHQVDFLPAFDSVLLMSDGEITEADTYQELLARSRDFQDLVNAHRETAGSERVVAVENPTKPVKEINRVISSQSKVLKPSRLIKQEEREKGDTGLRPYIQYMNQNKGYIFFFIASLAQVTFAVGQILQNSWMAANVDNPQVSTLKLILVYLLIGLCSVLCLMVRSVCVVIMCMKSSASLFSQLLNSLFRAPMSFYDSTPLGRILSRVSSDLSIVDLDV | 1453 | Damage-associated molecular patterns (DAMPs) | Natural | Binding leads to the secretion of the IL-18 | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Mice | Leukocytes and endothelial cells | Leucine-rich Repeat (LRR) Domain | Q9QUK6.fasta | Q9QUK6 | 835 | It promotes the inflammation and might be involved in the progression of inflammation during CD40L-induced autoimmunity. It is also crucial for the devlopment of CD8+ T cells | ELISA | 20473308 | 2010 | Pubchem Assay |
| PRRID_0690 | Mrp8 Click for more detail | Mice (others) | MPSELEKALSNLIDVYHNYSNIQGNHHALYKNDFKKMVTTECPQFVQNINIENLFRELDINSDNAINFEEFLAMVIKVGVASHKDSHKE | 89 | Damage-associated molecular patterns (DAMPs) | Natural | Binding leads to the secretion of the IL-17 | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Mice | Leukocytes and endothelial cells | Leucine-rich Repeat (LRR) Domain | Q9QUK6.fasta | Q9QUK6 | 835 | It promotes the inflammation and might be involved in the progression of inflammation during CD40L-induced autoimmunity. It is also crucial for the devlopment of CD8+ T cells | ELISA | 20473308 | 2010 | Pubchem Assay |
| PRRID_0690 | Mrp8 Click for more detail | Mice (others) | MPSELEKALSNLIDVYHNYSNIQGNHHALYKNDFKKMVTTECPQFVQNINIENLFRELDINSDNAINFEEFLAMVIKVGVASHKDSHKE | 89 | Damage-associated molecular patterns (DAMPs) | Natural | Binding leads to the secretion of the IL-17 | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Mice | Leukocytes and endothelial cells | Leucine-rich Repeat (LRR) Domain | Q9QUK6.fasta | Q9QUK6 | 835 | It promotes the inflammation and might be involved in the progression of inflammation during CD40L-induced autoimmunity. It is also crucial for the devlopment of CD8+ T cells | ELISA | 20473308 | 2010 | Pubchem Assay |
| PRRID_0691 | MsST Click for more detail | Streptococcus thermophilus lacZ (Bacteria) | MNMTEKIQTYLNDPKIVSVNTVDAHSDHKYFESLEEFSEGEMKLRQSLNGKWKIHYAQNTNQVLKDFYKTEFDETDLNFINVPGHLELQGFGSPQYVNTQYPWDGKEFLRPPQVPQESNAVASYVKHFTLNDALKDKKVFISFQGVATSIFVWVNGNFVGYSEDSFTPSEFEISDYLVEGDNKLAVAVYRYSTASWLEDQDFWRLYGIFRDVYLYAIPKVHVQDLFVKGDYDYQTKAGQLDIDLKTVGDYEDKKIKYVLSDYEGIVTEGDASVNGDGELSVSLENLKIKPWSAESPKLYDLILHVLDDDQVVEVVPVKVGFRRFEIKDKLMLLNGKRIVFKGVNRHEFNARTGRCITEEDMLWDIKVMKQHNINAVRTSHYPNQTRWYELCDEYGLYVIDEANLETHGTWQKLGLCEPSWNIPASEPEWLPACLDRANNMFQRDKNHASVIIWSCGNESYAGKDIADMADYFRSVDNTRPVHYEGVAWCREFDYITDIESRMYAKPADIEEYLTTGKLVDLSSVSDKHFASGNLTNKPQKPYISCEYMHTMGNSGGGLQLYTDLEKYPEYQGGFIWDFIDQAIYKTLPNGSEFLSYGGDWHDRPSDYEFCGNGIVFADRTLTPKLQTVKHLYSNIKIAVDEKSVTIKNDNLFEDLSAYTFLARVYEDGRKVSESEYHFDVKPGEEATFPVNFVVEASNSEQIYEVACVLREATEWAPKGHEIVRGQYVVEKISTETPVKAPLNVVEGDFNIGIQGQNFSILLSRAQNTLVSAKYNGVEFIEKGPKLSFTRAYTDNDRGAGYPFEMAGWKVAGNYSKVTDTQIQIEDDSVKVTYVHELPGLSDVEVKVTYQVDYKGRIFVTANYDGKAGLPNFPEFGLEFAIGSQFTNLSYYGYGAEESYRDKLPGAYLGRYETSVEKTFAPYLMPQESGNHYGTREFTVSDDNHNGLKFTALNKAFEFSALRNSTEQIENARHQYELQESDATWIKVLAAQMGVGGDDTW | 1026 | Nucleic Acid | Natural | It increases the number of CD80+CD11c+and CD86+CD11c+ dendritic cells and CD4+CD25+ regulatory T cells and also induces the production of IL-6. | Toll-like receptor 3 (TLR3) | Toll-like receptor (TLR) | Mice | Spleenocytes | LRR | Q99MB1.fasta | Q99MB1 | 905 | It is a potent stimulators of innate immunity. | ELISA | 20163626 | 2010 | Pubchem Assay |
| PRRID_0691 | MsST Click for more detail | Streptococcus thermophilus lacZ (Bacteria) | MNMTEKIQTYLNDPKIVSVNTVDAHSDHKYFESLEEFSEGEMKLRQSLNGKWKIHYAQNTNQVLKDFYKTEFDETDLNFINVPGHLELQGFGSPQYVNTQYPWDGKEFLRPPQVPQESNAVASYVKHFTLNDALKDKKVFISFQGVATSIFVWVNGNFVGYSEDSFTPSEFEISDYLVEGDNKLAVAVYRYSTASWLEDQDFWRLYGIFRDVYLYAIPKVHVQDLFVKGDYDYQTKAGQLDIDLKTVGDYEDKKIKYVLSDYEGIVTEGDASVNGDGELSVSLENLKIKPWSAESPKLYDLILHVLDDDQVVEVVPVKVGFRRFEIKDKLMLLNGKRIVFKGVNRHEFNARTGRCITEEDMLWDIKVMKQHNINAVRTSHYPNQTRWYELCDEYGLYVIDEANLETHGTWQKLGLCEPSWNIPASEPEWLPACLDRANNMFQRDKNHASVIIWSCGNESYAGKDIADMADYFRSVDNTRPVHYEGVAWCREFDYITDIESRMYAKPADIEEYLTTGKLVDLSSVSDKHFASGNLTNKPQKPYISCEYMHTMGNSGGGLQLYTDLEKYPEYQGGFIWDFIDQAIYKTLPNGSEFLSYGGDWHDRPSDYEFCGNGIVFADRTLTPKLQTVKHLYSNIKIAVDEKSVTIKNDNLFEDLSAYTFLARVYEDGRKVSESEYHFDVKPGEEATFPVNFVVEASNSEQIYEVACVLREATEWAPKGHEIVRGQYVVEKISTETPVKAPLNVVEGDFNIGIQGQNFSILLSRAQNTLVSAKYNGVEFIEKGPKLSFTRAYTDNDRGAGYPFEMAGWKVAGNYSKVTDTQIQIEDDSVKVTYVHELPGLSDVEVKVTYQVDYKGRIFVTANYDGKAGLPNFPEFGLEFAIGSQFTNLSYYGYGAEESYRDKLPGAYLGRYETSVEKTFAPYLMPQESGNHYGTREFTVSDDNHNGLKFTALNKAFEFSALRNSTEQIENARHQYELQESDATWIKVLAAQMGVGGDDTW | 1026 | Nucleic Acid | Natural | It increases the number of CD80+CD11c+and CD86+CD11c+ dendritic cells and CD4+CD25+ regulatory T cells and also induces the production of IL-6. | Toll-like receptor 3 (TLR3) | Toll-like receptor (TLR) | Mice | Spleenocytes | LRR | Q99MB1.fasta | Q99MB1 | 905 | It is a potent stimulators of innate immunity. | ELISA | 20163626 | 2010 | Pubchem Assay |
| PRRID_0694 | muramyl dipeptide (MDP) + LPS + Poly(I:C) Click for more detail | Bacteria | C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O | NA | Peptide | Natural | It help in NF | Nod-like receptor C4 (NLRC4) | NOD-like receptor (NLR) | C57BL/6 Mice | liver and Hepatocytes | NA | Q3UP24.fasta | Q3UP24 | 1024 | It plays an important regulatory role in many inflammatory processes involving the liver. | Immunoblotting and EMSA | 20615568 | 2010 | Pubchem Assay |
| PRRID_0694 | muramyl dipeptide (MDP) + LPS + Poly(I:C) Click for more detail | Bacteria | C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O | NA | Peptide | Natural | It help in NF | Nod-like receptor C4 (NLRC4) | NOD-like receptor (NLR) | C57BL/6 Mice | liver and Hepatocytes | NA | Q3UP24.fasta | Q3UP24 | 1024 | It plays an important regulatory role in many inflammatory processes involving the liver. | Immunoblotting and EMSA | 20615568 | 2010 | Pubchem Assay |
| PRRID_0696 | mutated SOD1 Click for more detail | exogenous (others) | NA | NA | Protein | Synthetic | NA | Toll-like receptor 14 (TLR14) | Toll-like receptor (TLR) | Mice | microglia | NA | P10810.fasta | P10810 | 366 | activation and toxicity of microglia | NA | 20706642 | 2010 | Pubchem Assay |
| PRRID_0696 | mutated SOD1 Click for more detail | exogenous (others) | NA | NA | Protein | Synthetic | NA | Toll-like receptor 14 (TLR14) | Toll-like receptor (TLR) | Mice | microglia | NA | P10810.fasta | P10810 | 366 | activation and toxicity of microglia | NA | 20706642 | 2010 | Pubchem Assay |