| 1001 | Vm24 | AAAISCVGSPECPPKCRAQGCKNGKCMNRKCKCYYC | 36 | L | None | Amidation | Cross linked by eight cysteines (between Cys6 and Cys26, Cys12 and Cys31, Cys16 and Cys33, and Cys21 and Cys36) (Disulphide linkage) | Linear | Natural | Venom of the Mexican scorpion Vaejovis mexicanus smithi | Block Kv1.3 channels with high affinity, an estimated Kd of 2.9 pM | Inhibits T Cell Proliferation, CD25 Expression, and Ca2+ Signaling In Vitro and Suppresses DTH Reactions In Vivo | Both | Human peripheral T Cells, COS-7, human embryonic kidney 293, tsA201, L929, and MEL cells | NA | Female Lewis rats (9-10 weeks of age) | T cell Proliferation assays | NA | NA | 22622363 | 2012 |
| 1011 | OSK1 (α-KTx3.7) | GVIINVKCKISRQCLEPCKKAGMRFGKCMNGKCHCTPK | 38 | L | None | None | Three- Disulphide-bridge C1-C4, C2-C5 and C3-C6) | Linear | Natural | Venom of the central Asian scorpion Orthochirus scrobiculosus | Kv 1.1, Kv 1.2 and Kv 1.3 channel and also Ca2+ activated KCa 3.1 channel | Potent blocker of three different Kv channel types and a moderate blocker of Ca2+ -activated KCa 3.1 channel | Both | L929 and MEL (murine erythroleukaemia), COS-7 cells, tsA cell line, LTK-cells (lacking leucocyte tyrosine kinase), CHL (Chinese-hamster lung) cells, HEK-293 (human embryonic kidney) cells | 0.60±0.04 nM for Kv1.1 | C57/BL6 mice | Neurotoxicity of peptide, Pharmacological activity on various K+ (Potassium) channel | 2.5 (μg/kg of mice) | NA | 15588251 | 2005 |
| 1012 | OSK1 (α-KTx3.7) | GVIINVKCKISRQCLEPCKKAGMRFGKCMNGKCHCTPK | 38 | L | None | None | Three- Disulphide-bridge (C1C4, C2-C5 and C3-C6) | Linear | Natural | Venom of the central Asian scorpion Orthochirus scrobiculosus | Kv 1.1, Kv 1.2 and Kv 1.3 channel and also Ca2+ -activated KCa 3.1 channel | Potent blocker of three different Kv channel types and a moderate blocker of Ca2+ -activated KCa 3.1 channel | Both | L929 and MEL (murine erythroleukaemia), COS-7 cells, tsA cell line, LTK-cells (lacking leucocyte tyrosine kinase), CHL (Chinese-hamster lung) cells, HEK-293 (human embryonic kidney) cells | 5.40±1.89 nM for Kv1.2 | C57/BL6 mice | Neurotoxicity of peptide, Pharmacological activity on various K+ (Potassium) channel | 2.5 (μg/kg of mice) | NA | 15588251 | 2005 |
| 1013 | OSK1 (α-KTx3.7) | GVIINVKCKISRQCLEPCKKAGMRFGKCMNGKCHCTPK | 38 | L | None | None | Three- Disulphide-bridge (C-C4, C2-C5 and C3-C6) | Linear | Natural | Venom of the central Asian scorpion Orthochirus scrobiculosus | Kv 1.1, Kv 1.2 and Kv 1.3 channel and also Ca2+ -activated KCa 3.1 channel | Potent blocker of three different Kv channel types and a moderate blocker of Ca2+ -activated KCa 3.1 channel | Both | L929 and MEL (murine erythroleukaemia), COS-7 cells, tsA cell line, LTK-cells (lacking leucocyte tyrosine kinase), CHL (Chinese-hamster lung) cells, HEK-293 (human embryonic kidney) cells | 0.014±0.001 nM for Kv1.3 | C57/BL6 mice | Neurotoxicity of peptide, Pharmacological activity on various K+ (Potassium) channel | 2.5 (μg/kg of mice) | NA | 15588251 | 2005 |
| 1014 | OSK1 (α-KTx3.7) | GVIINVKCKISRQCLEPCKKAGMRFGKCMNGKCHCTPK | 38 | L | None | None | Three- Disulphide-bridge C1-C4, C2-C5 and C3-C6) | Linear | Natural | Venom of the central Asian scorpion Orthochirus scrobiculosus | Kv 1.1, Kv 1.2 and Kv 1.3 channel and also Ca2+ -activated KCa 3.1 channel | Potent blocker of three different Kv channel types and a moderate blocker of Ca2+ -activated KCa 3.1 channel | Both | L929 and MEL (murine erythroleukaemia), COS-7 cells, tsA cell line, LTK-cells (lacking leucocyte tyrosine kinase), CHL (Chinese-hamster lung) cells, HEK-293 (human embryonic kidney) cells | 225±10 nM for Kca 3.1 | C57/BL6 mice | Neurotoxicity of peptide, Pharmacological activity on various K+ (Potassium) channel | 2.5 (μg/kg of mice) | NA | 15588251 | 2005 |
| 1015 | [K16 ,D20 ]-OSK1 | GVIINVKCKISRQCLKPCKDAGMRFGKCMNGKCHCTPK | 38 | L | None | None | Three- Disulphide-bridge (C1-C4, C2-C5 and C3-C6) | Linear | Synthetic | NA | Kv 1.1, Kv 1.2 and Kv 1.3 channel and also Ca2+ -activated KCa 3.1 channel | Potent blocker of three different Kv channel types and a moderate blocker of Ca2+ -activated KCa 3.1 channel | Both | L929 and MEL (murine erythroleukaemia), COS-7 cells, tsA cell line, LTK-cells (lacking leucocyte tyrosine kinase), CHL (Chinese-hamster lung) cells, HEK-293 (human embryonic kidney) cells | 0.40± 0.01 nM for Kv1.1 | C57/BL6 mice | Neurotoxicity of peptide, Pharmacological activity on various K+ (Potassium) channel | 2.5 (μg/kg of mice) | NA | 15588251 | 2005 |
| 1016 | [K16 ,D20 ]-OSK1 | GVIINVKCKISRQCLKPCKDAGMRFGKCMNGKCHCTPK | 38 | L | None | None | Three- Disulphide-bridge (C1-C4, C2-C5 and C3-C6) | Linear | Synthetic | NA | Kv 1.1, Kv 1.2 and Kv 1.3 channel and also Ca2+ -activated KCa 3.1 channel | Potent blocker of three different Kv channel types and a moderate blocker of Ca2+ -activated KCa 3.1 channel | Both | L929 and MEL (murine erythroleukaemia), COS-7 cells, tsA cell line, LTK-cells (lacking leucocyte tyrosine kinase), CHL (Chinese-hamster lung) cells, HEK-293 (human embryonic kidney) cells | 2.96±0.01 nM for Kv1.2 | C57/BL6 mice | Neurotoxicity of peptide, Pharmacological activity on various K+ (Potassium) channel | 2.5 (μg/kg of mice) | NA | 15588251 | 2005 |
| 1017 | [K16 ,D20 ]-OSK1 | GVIINVKCKISRQCLKPCKDAGMRFGKCMNGKCHCTPK | 38 | L | None | None | Three- Disulphide-bridge (C1-C4, C2-C5 and C3-C6) | Linear | Synthetic | NA | Kv 1.1, Kv 1.2 and Kv 1.3 channel and also Ca2+ -activated KCa 3.1 channel | Potent blocker of three different Kv channel types and a moderate blocker of Ca2+ -activated KCa 3.1 channel | Both | L929 and MEL (murine erythroleukaemia), COS-7 cells, tsA cell line, LTK-cells (lacking leucocyte tyrosine kinase), CHL (Chinese-hamster lung) cells, HEK-293 (human embryonic kidney) cells | 0.003± 0.0011 nM for Kv1.3 | C57/BL6 mice | Neurotoxicity of peptide, Pharmacological activity on various K+ (Potassium) channel | 2.5 (μg/kg of mice) | NA | 15588251 | 2005 |
| 1018 | [K16 ,D20 ]-OSK1 | GVIINVKCKISRQCLKPCKDAGMRFGKCMNGKCHCTPK | 38 | L | None | None | Three- Disulphide-bridge (C1-C4, C2-C5 and C3-C6) | Linear | Synthetic | NA | Kv 1.1, Kv 1.2 and Kv 1.3 channel and also Ca2+ -activated KCa 3.1 channel | Potent blocker of three different Kv channel types and a moderate blocker of Ca2+ -activated KCa 3.1 channel | Both | L929 and MEL (murine erythroleukaemia), COS-7 cells, tsA cell line, LTK-cells (lacking leucocyte tyrosine kinase), CHL (Chinese-hamster lung) cells, HEK-293 (human embryonic kidney) cells | 228±92 nM for Kca 3.1 | C57/BL6 mice | Neurotoxicity of peptide, Pharmacological activity on various K+ (Potassium) channel | 2.5 (μg/kg of mice) | NA | 15588251 | 2005 |
| 1019 | [K16 ]-OSK1 | GVIINVKCKISRQCLKPCKKAGMRFGKCMNGKCHCTPK | 38 | L | None | None | Three- Disulphide-bridge (C1-C4, C2-C5 and C3-C6) | Linear | Synthetic | NA | Kv 1.1, Kv 1.2 and Kv 1.3 channel and also Ca2+ -activated KCa 3.1 channel | Potent blocker of three different Kv channel types and a moderate blocker of Ca2+ -activated KCa 3.1 channel | Both | L929 and MEL (murine erythroleukaemia), COS-7 cells, tsA cell line, LTK-cells (lacking leucocyte tyrosine kinase), CHL (Chinese-hamster lung) cells, HEK-293 (human embryonic kidney) cells | 0.63±0.05 nM for Kv1.1 | C57/BL6 mice | Neurotoxicity of peptide, Pharmacological activity on various K+ (Potassium) channel | 3 (μg/kg of mice) | NA | 15588251 | 2005 |
| 1020 | [K16 ]-OSK1 | GVIINVKCKISRQCLKPCKKAGMRFGKCMNGKCHCTPK | 38 | L | None | None | Three- Disulphide-bridge (C1-C4, C2-C5 and C3-C6) | Linear | Synthetic | NA | Kv 1.1, Kv 1.2 and Kv 1.3 channel and also Ca2+ -activated KCa 3.1 channel | Potent blocker of three different Kv channel types and a moderate blocker of Ca2+ -activated KCa 3.1 channel | Both | L929 and MEL (murine erythroleukaemia), COS-7 cells, tsA cell line, LTK-cells (lacking leucocyte tyrosine kinase), CHL (Chinese-hamster lung) cells, HEK-293 (human embryonic kidney) cells | 5.23±0.22 nM for Kv1.2 | C57/BL6 mice | Neurotoxicity of peptide, Pharmacological activity on various K+ (Potassium) channel | 3 (μg/kg of mice) | NA | 15588251 | 2005 |
| 1021 | [K16 ]-OSK1 | GVIINVKCKISRQCLKPCKKAGMRFGKCMNGKCHCTPK | 38 | L | None | None | Three- Disulphide-bridge (C1-C4, C2-C5 and C3-C6) | Linear | Synthetic | NA | Kv 1.1, Kv 1.2 and Kv 1.3 channel and also Ca2+ -activated KCa 3.1 channel | Potent blocker of three different Kv channel types and a moderate blocker of Ca2+ -activated KCa 3.1 channel | Both | L929 and MEL (murine erythroleukaemia), COS-7 cells, tsA cell line, LTK-cells (lacking leucocyte tyrosine kinase), CHL (Chinese-hamster lung) cells, HEK-293 (human embryonic kidney) cells | 0.067±0.006 nM for Kv1.3 | C57/BL6 mice | Neurotoxicity of peptide, Pharmacological activity on various K+ (Potassium) channel | 3 (μg/kg of mice) | NA | 15588251 | 2005 |
| 1022 | [K16 ]-OSK1 | GVIINVKCKISRQCLKPCKKAGMRFGKCMNGKCHCTPK | 38 | L | None | None | Three- Disulphide-bridge (C1-C4, C2-C5 and C3-C6) | Linear | Synthetic | NA | Kv 1.1, Kv 1.2 and Kv 1.3 channel and also Ca2+ -activated KCa 3.1 channel | Potent blocker of three different Kv channel types and a moderate blocker of Ca2+ -activated KCa 3.1 channel | Both | L929 and MEL (murine erythroleukaemia), COS-7 cells, tsA cell line, LTK-cells (lacking leucocyte tyrosine kinase), CHL (Chinese-hamster lung) cells, HEK-293 (human embryonic kidney) cells | 151±21 nM for Kca 3.1 | C57/BL6 mice | Neurotoxicity of peptide, Pharmacological activity on various K+ (Potassium) channel | 3 (μg/kg of mice) | NA | 15588251 | 2005 |
| 1023 | [D20 ]-OSK1 | GVIINVKCKISRQCLEPCKDAGMRFGKCMNGKCHCTPK | 38 | L | None | None | Three- Disulphide-bridge (C1-C4, C2-C5 and C3-C6) | Linear | Synthetic | NA | Kv 1.1, Kv 1.2 and Kv 1.3 channel and also Ca2+ -activated KCa 3.1 channel | Potent blocker of three different Kv channel types and a moderate blocker of Ca2+ -activated KCa 3.1 channel | Both | L929 and MEL (murine erythroleukaemia), COS-7 cells, tsA cell line, LTK-cells (lacking leucocyte tyrosine kinase), CHL (Chinese-hamster lung) cells, HEK-293 (human embryonic kidney) cells | 2.95±0.24 nM for Kv1.1 | C57/BL6 mice | Neurotoxicity of peptide, Pharmacological activity on various K+ (Potassium) channel | 4.5 (μg/kg of mice) | NA | 15588251 | 2005 |
| 1024 | [D20 ]-OSK1 | GVIINVKCKISRQCLEPCKDAGMRFGKCMNGKCHCTPK | 38 | L | None | None | Three- Disulphide-bridge (C1-C4, C2-C5 and C3-C6) | Linear | Synthetic | NA | Kv 1.1, Kv 1.2 and Kv 1.3 channel and also Ca2+ -activated KCa 3.1 channel | Potent blocker of three different Kv channel types and a moderate blocker of Ca2+ -activated KCa 3.1 channel | Both | L929 and MEL (murine erythroleukaemia), COS-7 cells, tsA cell line, LTK-cells (lacking leucocyte tyrosine kinase), CHL (Chinese-hamster lung) cells, HEK-293 (human embryonic kidney) cells | 77.8± 9.2 nM for Kv1.2 | C57/BL6 mice | Neurotoxicity of peptide, Pharmacological activity on various K+ (Potassium) channel | 4.5 (μg/kg of mice) | NA | 15588251 | 2005 |
| 1025 | [D20 ]-OSK1 | GVIINVKCKISRQCLEPCKDAGMRFGKCMNGKCHCTPK | 38 | L | None | None | Three- Disulphide-bridge (C1-C4, C2-C5 and C3-C6) | Linear | Synthetic | NA | Kv 1.1, Kv 1.2 and Kv 1.3 channel and also Ca2+ -activated KCa 3.1 channel | Potent blocker of three different Kv channel types and a moderate blocker of Ca2+ -activated KCa 3.1 channel | Both | L929 and MEL (murine erythroleukaemia), COS-7 cells, tsA cell line, LTK-cells (lacking leucocyte tyrosine kinase), CHL (Chinese-hamster lung) cells, HEK-293 (human embryonic kidney) cells | 0.037±0.007 nM for Kv1.3 | C57/BL6 mice | Neurotoxicity of peptide, Pharmacological activity on various K+ (Potassium) channel | 4.5 (μg/kg of mice) | NA | 15588251 | 2005 |
| 1026 | [D20 ]-OSK1 | GVIINVKCKISRQCLEPCKDAGMRFGKCMNGKCHCTPK | 38 | L | None | None | Three- Disulphide-bridge (C1-C4, C2-C5 and C3-C6) | Linear | Synthetic | NA | Kv 1.1, Kv 1.2 and Kv 1.3 channel and also Ca2+ -activated KCa 3.1 channel | Potent blocker of three different Kv channel types and a moderate blocker of Ca2+ -activated KCa 3.1 channel | Both | L929 and MEL (murine erythroleukaemia), COS-7 cells, tsA cell line, LTK-cells (lacking leucocyte tyrosine kinase), CHL (Chinese-hamster lung) cells, HEK-293 (human embryonic kidney) cells | 716±10 nM for Kca 3.1 | C57/BL6 mice | Neurotoxicity of peptide, Pharmacological activity on various K+ (Potassium) channel | 4.5 (μg/kg of mice) | NA | 15588251 | 2005 |
| 1027 | [P12 ,K16 , D20]-OSK1 | GVIINVKCKISPQCLKPCKDAGMRFGKCMNGKCHCTPK | 38 | L | None | None | Three- Disulphide-bridge (C1-C4, C2-C5 and C3-C6) | Linear | Synthetic | NA | Kv 1.1, Kv 1.2 and Kv 1.3 channel and also Ca2+ -activated KCa 3.1 channel | Potent blocker of three different Kv channel types and a moderate blocker of Ca2+ -activated KCa 3.1 channel | Both | L929 and MEL (murine erythroleukaemia), COS-7 cells, tsA cell line, LTK-cells (lacking leucocyte tyrosine kinase), CHL (Chinese-hamster lung) cells, HEK-293 (human embryonic kidney) cells | 3.18± 0.11 nM for Kv1.1 | C57/BL6 mice | Neurotoxicity of peptide, Pharmacological activity on various K+ (Potassium) channel | 7.5 (μg/kg of mice) | NA | 15588251 | 2005 |
| 1028 | [P12 ,K16 , D20]-OSK1 | GVIINVKCKISPQCLKPCKDAGMRFGKCMNGKCHCTPK | 38 | L | None | None | Three- Disulphide-bridge (C1-C4, C2-C5 and C3-C6) | Linear | Synthetic | NA | Kv 1.1, Kv 1.2 and Kv 1.3 channel and also Ca2+ -activated KCa 3.1 channel | Potent blocker of three different Kv channel types and a moderate blocker of Ca2+ -activated KCa 3.1 channel | Both | L929 and MEL (murine erythroleukaemia), COS-7 cells, tsA cell line, LTK-cells (lacking leucocyte tyrosine kinase), CHL (Chinese-hamster lung) cells, HEK-293 (human embryonic kidney) cells | 196±9 nM for Kv1.2 | C57/BL6 mice | Neurotoxicity of peptide, Pharmacological activity on various K+ (Potassium) channel | 7.5 (μg/kg of mice) | NA | 15588251 | 2005 |
| 1029 | [P12 ,K16 , D20]-OSK1 | GVIINVKCKISPQCLKPCKDAGMRFGKCMNGKCHCTPK | 38 | L | None | None | Three- Disulphide-bridge (C1-C4, C2-C5 and C3-C6) | Linear | Synthetic | NA | Kv 1.1, Kv 1.2 and Kv 1.3 channel and also Ca2+ -activated KCa 3.1 channel | Potent blocker of three different Kv channel types and a moderate blocker of Ca2+ -activated KCa 3.1 channel | Both | L929 and MEL (murine erythroleukaemia), COS-7 cells, tsA cell line, LTK-cells (lacking leucocyte tyrosine kinase), CHL (Chinese-hamster lung) cells, HEK-293 (human embryonic kidney) cells | 0.059±0.003 nM for Kv1.3 | C57/BL6 mice | Neurotoxicity of peptide, Pharmacological activity on various K+ (Potassium) channel | 7.5 (μg/kg of mice) | NA | 15588251 | 2005 |
| 1030 | [P12 ,K16 , D20]-OSK1 | GVIINVKCKISPQCLKPCKDAGMRFGKCMNGKCHCTPK | 38 | L | None | None | Three- Disulphide-bridge (C1-C4, C2-C5 and C3-C6) | Linear | Synthetic | NA | Kv 1.1, Kv 1.2 and Kv 1.3 channel and also Ca2+ -activated KCa 3.1 channel | Potent blocker of three different Kv channel types and a moderate blocker of Ca2+ -activated KCa 3.1 channel | Both | L929 and MEL (murine erythroleukaemia), COS-7 cells, tsA cell line, LTK-cells (lacking leucocyte tyrosine kinase), CHL (Chinese-hamster lung) cells, HEK-293 (human embryonic kidney) cells | 2600±400 nM for Kca 3.1 | C57/BL6 mice | Neurotoxicity of peptide, Pharmacological activity on various K+ (Potassium) channel | 7.5 (μg/kg of mice) | NA | 15588251 | 2005 |
| 1031 | [K16,D20,Y36]-OSK1 | GVIINVKCKISRQCLKPCKDAGMRFGKCMNGKCHCYPK | 38 | L | None | None | Three- Disulphide-bridge (C1-C4, C2-C5 and C3-C6) | Linear | Synthetic | NA | Kv 1.1, Kv 1.2, Kv 1.3 and Kv 1.7 channel and also Ca2+ -activated KCa 3.1 channel | Blocker of four different Kv channel types and also blocker of Ca2+ -activated KCa 3.1 channel | Both | L929 and MEL (murine erythroleukaemia), COS-7 cells, tsA cell line, LTK-cells (lacking leucocyte tyrosine kinase), CHL (Chinese-hamster lung) cells, HEK-293 (human embryonic kidney) cells | 34.4±0.3 nM for Kv1.1 | C57/BL6 mice | Neurotoxicity of peptide, Pharmacological activity on various K+ (Potassium) channel | 9 (μg/kg of mice) | NA | 15588251 | 2005 |
| 1032 | [K16,D20,Y36]-OSK1 | GVIINVKCKISRQCLKPCKDAGMRFGKCMNGKCHCYPK | 38 | L | None | None | Three- Disulphide-bridge (C1-C4, C2-C5 and C3-C6) | Linear | Synthetic | NA | Kv 1.1, Kv 1.2, Kv 1.3 and Kv 1.7 channel and also Ca2+ -activated KCa 3.1 channel | Blocker of four different Kv channel types and also blocker of Ca2+ -activated KCa 3.1 channel | Both | L929 and MEL (murine erythroleukaemia), COS-7 cells, tsA cell line, LTK-cells (lacking leucocyte tyrosine kinase), CHL (Chinese-hamster lung) cells, HEK-293 (human embryonic kidney) cells | 232±11 nM for Kv1.2 | C57/BL6 mice | Neurotoxicity of peptide, Pharmacological activity on various K+ (Potassium) channel | 9 (μg/kg of mice) | NA | 15588251 | 2005 |
| 1033 | [K16,D20,Y36]-OSK1 | GVIINVKCKISRQCLKPCKDAGMRFGKCMNGKCHCYPK | 38 | L | None | None | Three- Disulphide-bridge (C1-C4, C2-C5 and C3-C6) | Linear | Synthetic | NA | Kv 1.1, Kv 1.2, Kv 1.3 and Kv 1.7 channel and also Ca2+ -activated KCa 3.1 channel | Blocker of four different Kv channel types and also blocker of Ca2+ -activated KCa 3.1 channel | Both | L929 and MEL (murine erythroleukaemia), COS-7 cells, tsA cell line, LTK-cells (lacking leucocyte tyrosine kinase), CHL (Chinese-hamster lung) cells, HEK-293 (human embryonic kidney) cells | 0.122± 0.007 nM for Kv1.3 | C57/BL6 mice | Neurotoxicity of peptide, Pharmacological activity on various K+ (Potassium) channel | 9 (μg/kg of mice) | NA | 15588251 | 2005 |
| 1034 | [K16,D20,Y36]-OSK1 | GVIINVKCKISRQCLKPCKDAGMRFGKCMNGKCHCYPK | 38 | L | None | None | Three- Disulphide-bridge (C1-C4, C2-C5 and C3-C6) | Linear | Synthetic | NA | Kv 1.1, Kv 1.2, Kv 1.3 and Kv 1.7 channel and also Ca2+ -activated KCa 3.1 channel | Blocker of four different Kv channel types and also blocker of Ca2+ -activated KCa 3.1 channel | Both | L929 and MEL (murine erythroleukaemia), COS-7 cells, tsA cell line, LTK-cells (lacking leucocyte tyrosine kinase), CHL (Chinese-hamster lung) cells, HEK-293 (human embryonic kidney) cells | 1500±500 nM for Kv1.7 | C57/BL6 mice | Neurotoxicity of peptide, Pharmacological activity on various K+ (Potassium) channel | 9 (μg/kg of mice) | NA | 15588251 | 2005 |
| 1035 | [K16,D20,Y36]-OSK1 | GVIINVKCKISRQCLKPCKDAGMRFGKCMNGKCHCYPK | 38 | L | None | None | Three- Disulphide-bridge (C1-C4, C2-C5 and C3-C6) | Linear | Synthetic | NA | Kv 1.1, Kv 1.2, Kv 1.3 and Kv 1.7 channel and also Ca2+ -activated KCa 3.1 channel | Blocker of four different Kv channel types and also blocker of Ca2+ -activated KCa 3.1 channel | Both | L929 and MEL (murine erythroleukaemia), COS-7 cells, tsA cell line, LTK-cells (lacking leucocyte tyrosine kinase), CHL (Chinese-hamster lung) cells, HEK-293 (human embryonic kidney) cells | 885±18 nM for Kca 3.1 | C57/BL6 mice | Neurotoxicity of peptide, Pharmacological activity on various K+ (Potassium) channel | 9 (μg/kg of mice) | NA | 15588251 | 2005 |
| 1051 | Vm24 | AAAISCVGSPECPPKCRAQGCKNGKCMNRKCKCYYC | 36 | L | None | Amidation | Four Disulfide bridges (between Cys6 and Cys26, Cys12 and Cys31, Cys16 and Cys33, and Cys21 and Cys36) | Linear | Natural | venom of the Mexican scorpion Vaejovis mexicanus smithi | K+ channel | Remarkable blocking potency and selectivity for Kv1.3 channels | Both | Mononuclear cells from human peripheral venous blood | 90% inhibition achieved at 100pM | Mouse model | Lethality test | No toxicity for 50 to 200 μg of protein per mouse (20 g body weight) | NA | 22540187 | 2012 |
| 1052 | Margatoxin | TIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH | 39 | L | None | None | None | Linear | Natural | Purified from venom of the scorpion Centruroides margaritatus | Kv1.3 channel | Inhibit both Th1 and Th2 cytokine production | NA | NA | NA | NA | NA | NA | NA | 12747950 | 2003 |
| 1053 | Margatoxin | TIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH | 39 | L | None | None | None | Linear | Synthetic | Recombinantnt was made by expressing the synthetic cDNA in Escherichia coli | Kv1.3 channel | Inhibit both Th1 and Th2 cytokine production | Both | Human peripheral blood mononuclear cells (PBMC), Purified T cells, Human monocytes, Human monocytic cell line, THP-1 | 0.013 nM for IL-2 when stimulation with PMA and ionomycin | Mini swine model | Proliferation asaay, detection of intracellular cytokines, Antibody-dependent cellular cytotoxicity assay | NA | NA | 12747950 | 2003 |
| 1054 | Margatoxin | TIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH | 39 | L | None | None | None | Linear | Synthetic | Recombinantnt was made by expressing the synthetic cDNA in Escherichia coli | Kv1.3 channel | Inhibit both Th1 and Th2 cytokine production | Both | Human peripheral blood mononuclear cells (PBMC), Purified T cells, Human monocytes, Human monocytic cell line, THP-2 | 0.016 nM for IL-4 when stimulation with PMA and ionomycin | Mini swine model | Proliferation asaay, detection of intracellular cytokines, Antibody-dependent cellular cytotoxicity assay | NA | NA | 12747950 | 2003 |
| 1055 | Margatoxin | TIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH | 39 | L | None | None | None | Linear | Synthetic | Recombinantnt was made by expressing the synthetic cDNA in Escherichia coli | Kv1.3 channel | Inhibit both Th1 and Th2 cytokine production | Both | Human peripheral blood mononuclear cells (PBMC), Purified T cells, Human monocytes, Human monocytic cell line, THP-3 | 0.5 nM for IL-2 production when stimulated with a-CD3 and VCAM-1 | Mini swine model | Proliferation asaay, detection of intracellular cytokines, Antibody-dependent cellular cytotoxicity assay | NA | NA | 12747950 | 2003 |
| 1056 | Margatoxin | TIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH | 39 | L | None | None | None | Linear | Synthetic | Recombinantnt was made by expressing the synthetic cDNA in Escherichia coli | Kv1.3 channel | Inhibit both Th1 and Th2 cytokine production | Both | Human peripheral blood mononuclear cells (PBMC), Purified T cells, Human monocytes, Human monocytic cell line, THP-4 | 0.13 nM for IL-4 production when stimulated with a-CD3 and VCAM-1 | Mini swine model | Proliferation asaay, detection of intracellular cytokines, Antibody-dependent cellular cytotoxicity assay | NA | NA | 12747950 | 2003 |
| 1057 | Margatoxin | TIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH | 39 | L | None | None | None | Linear | Synthetic | Recombinantnt was made by expressing the synthetic cDNA in Escherichia coli | Kv1.3 channel | Inhibit both Th1 and Th2 cytokine production | Both | Human peripheral blood mononuclear cells (PBMC), Purified T cells, Human monocytes, Human monocytic cell line, THP-5 | 4.9 nM for a-CD3/VCAM-1 induced proliferation | Mini swine model | Proliferation asaay, detection of intracellular cytokines, Antibody-dependent cellular cytotoxicity assay | NA | NA | 12747950 | 2003 |
| 1058 | Margatoxin | TIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH | 39 | L | None | None | None | Linear | Synthetic | Recombinantnt was made by expressing the synthetic cDNA in Escherichia coli | Kv1.3 channel | Inhibit both Th1 and Th2 cytokine production | Both | Human peripheral blood mononuclear cells (PBMC), Purified T cells, Human monocytes, Human monocytic cell line, THP-6 | 0.5 nM anti-CD3 mediated redirected cytolysis of CD8(+) T cells | Mini swine model | Proliferation asaay, detection of intracellular cytokines, Antibody-dependent cellular cytotoxicity assay | NA | NA | 12747950 | 2003 |
| 1059 | Margatoxin | TIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH | 39 | L | None | None | None | Linear | Synthetic | Recombinantnt was made by expressing the synthetic cDNA in Escherichia coli | Kv1.3 channel | Inhibit both Th1 and Th2 cytokine production | Both | Human peripheral blood mononuclear cells (PBMC), Purified T cells, Human monocytes, Human monocytic cell line, THP-7 | 0.5 nM anti-CD3 mediated redirected cytolysis of T cells | Mini swine model | Proliferation asaay, detection of intracellular cytokines, Antibody-dependent cellular cytotoxicity assay | NA | NA | 12747950 | 2003 |
| 1060 | Margatoxin | TIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH | 39 | L | None | None | None | Linear | Natural | From venom of the new world scorpion Centruroides margaritatus | Kv1.3 channels | Blocks with high affinity and specificity the Kv1.3 channel | In vitro | Human peripheral T-Lymphocytes, rat brain synaptic plasma membrane vesicles, bovine aortic sarcolemmal membrane vesicle | 36 pM | NA | competition binding with Kv1.3 (Potassium channel) | NA | NA | 8360176 | 1993 |
| 1061 | Charybdotoxin (ChTX) | EFTNVSCTTSKECWSVCQRLHNTSRGKCMNKKCRCYS | 37 | L | None | None | None | Linear | Natural | Isolated from venom of the old world scorpion Leiurusguinqwstriutus var. hebraeus | Kv1.3 channels | Inhibit high conductance, Ca2+- activated K+ (Maxi-K) channel | In vitro | Human peripheral T-Lymphocytes, rat brain synaptic plasma membrane vesicles, bovine aortic sarcolemmal membrane vesicle | NA | NA | competition binding with Kv1.4 ((Potassium channel) | NA | NA | 8360176 | 1993 |
| 1062 | Charybdotoxin (ChTX) | EFTNVSCTTSKECWSVCQRLHNTSRGKCMNKKCRCYS | 37 | L | None | None | None | Linear | Natural | Venom of the scorpion Leiurusquin questriatus var. hebraeus | K+ channels | Potent selective block of apamin-insensitive Ca2+- activated K+ channels | In vitro | GH3 pitutary cells and aortic smooth muscle | NA | NA | NA | NA | NA | 2453055 | 1988 |
| 1076 | CKS-17 | LQNRRGLDLLFLKEGGL | 17 | L | None | Conjugated to HSA (human serum albumin) | None | Linear | Synthetic | Homologous region found in the transmembrane envelope proteins of murine, feline, and human retro- viruses HTLV-1 and HTLV-2, and an endogenous C-type human retrovirus | Protein Kinase C | Inhibits Protein Kinase C activity | In vitro | Human Neutrophils, Lymphoblastoid cell line-Jurkat cell | 3 micromolar in the in vitro protein kinase C assay | None | Protein kinase assay | NA | NA | 1921761 | 1991 |
| 1077 | CKS-17 | LQNRRGLDLLFLKEGGL | 17 | L | None | Conjugated to BSA (bovine serum albumin) | None | Linear | Synthetic | Homologous region found in the transmembrane envelope proteins of murine, feline, and human retro- viruses HTLV-1 and HTLV-2, and an endogenous C-type human retrovirus | Protein Kinase C | inhibition of IL-1-mediated responses, due to inactivation of PKC. inactivates PKC directly without competing with its cofactors. | In vitro | Human Neutrophils, Lymphoblastoid cell line-Jurkat cell | 3 micromolar in the in vitro protein kinase C assay | None | Protein kinase assay | NA | NA | 1921761 | 1991 |
| 1121 | Charybdotoxin (Venom peptide) | XFTNVSCTTSKECWSVCQRLHNTSRGKCMNKKCRCYS | 37 | L | None | None | X=PyroGlutamic acid | Linear | Natural | Leiurus quinquestriatus hebraeus (scorpion) | K+ (potassium) channel | Potassium channel blocker | In vitro | NA | NA | NA | NA | NA | NA | 24333193 | 2014 |
| 1125 | Iberiotoxin (Venom peptide) | XFTDVDCSVSKECWSVCKDLFGVDRGKCMGKKCRCYQ | 37 | L | None | None | X=Pyroglutamic acid and disulfile linkage at Disulfide bridges: Cys7 - Cys28, Cys13 - Cys33, Cys17 - Cys35 | Linear | Natural | Buthus tamulus (scorpion) | Blocker of several BK channels | Bloackion channels | Both | NA | NA | NA | NA | NA | NA | 24333193 | 2014 |
| 1127 | Kaliotoxin (Venom peptide) | GVEINVKCSGSPQCLKPCLDAGMRFGKCMNRKCHCTPK | 38 | L | None | None | None | Linear | Natural | Androctonus mauretanicus (scorpion) | K+ channel | Potassium channel blocker | In vitro | NA | NA | NA | NA | NA | NA | 24333193 | 2014 |
| 1128 | Magatoxin (Venom peptide) | IINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH | 39 | L | None | None | disulfide bridges between Cys 7-Cys29, Cys13-Cys34 and Cys17-Cys36 | Linear | Natural | Centruroides margaritatus (scorpion) | K+ channel | Potassium channel blocker | In vivo | NA | NA | NA | NA | NA | NA | 24333193 | 2014 |
| 1129 | OSK-1 (alpha-KTx3.7) (Venom peptide) | GVIINVKCKISRQCLEPCKKAGMRFGKCMNGKCHCTPK | 38 | L | None | None | None | Linear | Natural | Orthochirus scrobiculosus (scorpion) | K+ channel | Potassium channel blocker | Both | NA | NA | C57/BL6 mice | NA | 10 mg/kg | NA | 24333193 | 2014 |
| 1132 | Vm24 | AAAISCVGSPECPPKCRAQGCKNGKCMNRKCKCYYC | 36 | L | None | None | None | Linear | Natural | Vaejovis mexicanus smithi (scorpion) | Kv1.3 channels | Inhibits Kv1.3 channels | Both | COS-7, human embryonic kidney 293, tsA201, L929 and MEL cells | NA | Female Lewis rat (9-10 weeks of age) | Proliferation assay | NA | NA | 22622363 | 2012 |
| 1140 | CKS-17 | LQNRRGLDLLFLKEGGL | 17 | L | None | None | None | Linear | Synthetic | NA | Protein kinase | Activates mitogen-activated protein (MAP) kinases extracellular signal-regulated kinase 1 and 2 (ERK1/2) | In vitro | Human monocytic cell line THP-1 | NA | NA | NA | NA | NA | 11359835 | 2001 |
| 1180 | Immunosuppressive epitope of retroviral plSE | not available | 17 | L | None | None | None | Linear | Protein Derived | Retroviral protein pl5E | IL-2, TNF-α, protein kinase-C | Inhibits human mitogen and alloantigen-stimulated lymphocyte proliferation, natural killer cell activity, interleukin 1-mediated monocyte tumor killing, interleukin 2 production, immunoglobulin synthesis, TNF-α mRNA expression and protein kinase C activity | Both | U937, P2, JLS-V5 | NA | BALB/c mice (Female, 12- week-old) | NA | NA | NA | 7511054 | 1994 |
| 1199 | LffX-I | VGINVKCKHSRQCLKPCKDAGMRFGKCTNGKCHCTPK | 37 | L | None | None | None | Linear | Natural | Scorpion venom | Kv1.3 potassium channels of T cells | high specificity binding Kv1.3 potassium channels of T cells | Both | C0S-7 cells | 1.08 pM | Arthritic Lewis rats, EAE model of Wistar rats | NA | NA | NA | CN 101423550 B | 2012 |
| 1200 | LWX-AD-1 | NEAVPTGGCPFSDFFCAKRCKDMKFGNTGRCTGPNKTVCKCSI | 43 | L | None | None | None | Linear | Natural | Scorpion venom | Kv1.3 potassium channels of T cells | high specificity binding Kv1.3 potassium channels of T cells | Both | C0S-7 cells | 0.52 nM | Arthritic Lewis rats, EAE model of Wistar rats | NA | NA | NA | CN 101423550 B | 2012 |
