| Primary information |
|---|
| ID | 1199 |
| Peptide Name | LffX-I |
| Sequence | VGINVKCKHSRQCLKPCKDAGMRFGKCTNGKCHCTPK |
| Length | 37 |
| Chirality | L |
| N-terminal Modification | None |
| C-terminal Modification | None |
| Chemical Modification | None |
| Linear/ Cyclic | Linear |
| Nature | Natural |
| Source of Origin | Scorpion venom |
| Target | Kv1.3 potassium channels of T cells |
| Mechanism of Action | high specificity binding Kv1.3 potassium channels of T cells |
| In vitro/In vivo | Both |
| Cell Line | C0S-7 cells |
| Inhibition Concentartion | 1.08 pM |
| In vivo Model | Arthritic Lewis rats, EAE model of Wistar rats |
| Assay | NA |
| Lethal Dose | NA |
| Combination Therapy | NA |
| Pubmed ID | CN 101423550 B |
| Year of Publication | 2012 |
| 3-D Structure |  View in Jmol or Download Structure |
