| Primary information |
|---|
| ID | 1129 |
| Peptide Name | OSK-1 (alpha-KTx3.7) (Venom peptide) |
| Sequence | GVIINVKCKISRQCLEPCKKAGMRFGKCMNGKCHCTPK |
| Length | 38 |
| Chirality | L |
| N-terminal Modification | None |
| C-terminal Modification | None |
| Chemical Modification | None |
| Linear/ Cyclic | Linear |
| Nature | Natural |
| Source of Origin | Orthochirus scrobiculosus (scorpion) |
| Target | K+ channel |
| Mechanism of Action | Potassium channel blocker |
| In vitro/In vivo | Both |
| Cell Line | NA |
| Inhibition Concentartion | NA |
| In vivo Model | C57/BL6 mice |
| Assay | NA |
| Lethal Dose | 10 mg/kg |
| Combination Therapy | NA |
| Pubmed ID | 24333193 |
| Year of Publication | 2014 |
| 3-D Structure |  View in Jmol or Download Structure |
