Primary information |
---|
ID | 1128 |
Peptide Name | Magatoxin (Venom peptide) |
Sequence | IINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH |
Length | 39 |
Chirality | L |
N-terminal Modification | None |
C-terminal Modification | None |
Chemical Modification | disulfide bridges between Cys 7-Cys29, Cys13-Cys34 and Cys17-Cys36 |
Linear/ Cyclic | Linear |
Nature | Natural |
Source of Origin | Centruroides margaritatus (scorpion) |
Target | K+ channel |
Mechanism of Action | Potassium channel blocker |
In vitro/In vivo | In vivo |
Cell Line | NA |
Inhibition Concentartion | NA |
In vivo Model | NA |
Assay | NA |
Lethal Dose | NA |
Combination Therapy | NA |
Pubmed ID | 24333193 |
Year of Publication | 2014 |
3-D Structure | NA |