| Primary information |
|---|
| ID | 1062 |
| Peptide Name | Charybdotoxin (ChTX) |
| Sequence | EFTNVSCTTSKECWSVCQRLHNTSRGKCMNKKCRCYS |
| Length | 37 |
| Chirality | L |
| N-terminal Modification | None |
| C-terminal Modification | None |
| Chemical Modification | None |
| Linear/ Cyclic | Linear |
| Nature | Natural |
| Source of Origin | Venom of the scorpion Leiurusquin questriatus var. hebraeus |
| Target | K+ channels |
| Mechanism of Action | Potent selective block of apamin-insensitive Ca2+- activated K+ channels |
| In vitro/In vivo | In vitro |
| Cell Line | GH3 pitutary cells and aortic smooth muscle |
| Inhibition Concentartion | NA |
| In vivo Model | NA |
| Assay | NA |
| Lethal Dose | NA |
| Combination Therapy | NA |
| Pubmed ID | 2453055 |
| Year of Publication | 1988 |
| 3-D Structure |  View in Jmol or Download Structure |
