Primary information |
---|
ID | 1200 |
Peptide Name | LWX-AD-1 |
Sequence | NEAVPTGGCPFSDFFCAKRCKDMKFGNTGRCTGPNKTVCKCSI |
Length | 43 |
Chirality | L |
N-terminal Modification | None |
C-terminal Modification | None |
Chemical Modification | None |
Linear/ Cyclic | Linear |
Nature | Natural |
Source of Origin | Scorpion venom |
Target | Kv1.3 potassium channels of T cells |
Mechanism of Action | high specificity binding Kv1.3 potassium channels of T cells |
In vitro/In vivo | Both |
Cell Line | C0S-7 cells |
Inhibition Concentartion | 0.52 nM |
In vivo Model | Arthritic Lewis rats, EAE model of Wistar rats |
Assay | NA |
Lethal Dose | NA |
Combination Therapy | NA |
Pubmed ID | CN 101423550 B |
Year of Publication | 2012 |
3-D Structure | View in Jmol or Download Structure |