| Primary information |
|---|
| ID | 1020 |
| Peptide Name | [K16 ]-OSK1 |
| Sequence | GVIINVKCKISRQCLKPCKKAGMRFGKCMNGKCHCTPK |
| Length | 38 |
| Chirality | L |
| N-terminal Modification | None |
| C-terminal Modification | None |
| Chemical Modification | Three- Disulphide-bridge (C1-C4, C2-C5 and C3-C6) |
| Linear/ Cyclic | Linear |
| Nature | Synthetic |
| Source of Origin | NA |
| Target | Kv 1.1, Kv 1.2 and Kv 1.3 channel and also Ca2+ -activated KCa 3.1 channel |
| Mechanism of Action | Potent blocker of three different Kv channel types and a moderate blocker of Ca2+ -activated KCa 3.1 channel |
| In vitro/In vivo | Both |
| Cell Line | L929 and MEL (murine erythroleukaemia), COS-7 cells, tsA cell line, LTK-cells (lacking leucocyte tyrosine kinase), CHL (Chinese-hamster lung) cells, HEK-293 (human embryonic kidney) cells |
| Inhibition Concentartion | 5.23±0.22 nM for Kv1.2 |
| In vivo Model | C57/BL6 mice |
| Assay | Neurotoxicity of peptide, Pharmacological activity on various K+ (Potassium) channel |
| Lethal Dose | 3 (μg/kg of mice) |
| Combination Therapy | NA |
| Pubmed ID | 15588251 |
| Year of Publication | 2005 |
| 3-D Structure | NA |
