| Primary information |
|---|
| ID | 1132 |
| Peptide Name | Vm24 |
| Sequence | AAAISCVGSPECPPKCRAQGCKNGKCMNRKCKCYYC |
| Length | 36 |
| Chirality | L |
| N-terminal Modification | None |
| C-terminal Modification | None |
| Chemical Modification | None |
| Linear/ Cyclic | Linear |
| Nature | Natural |
| Source of Origin | Vaejovis mexicanus smithi (scorpion) |
| Target | Kv1.3 channels |
| Mechanism of Action | Inhibits Kv1.3 channels |
| In vitro/In vivo | Both |
| Cell Line | COS-7, human embryonic kidney 293, tsA201, L929 and MEL cells |
| Inhibition Concentartion | NA |
| In vivo Model | Female Lewis rat (9-10 weeks of age) |
| Assay | Proliferation assay |
| Lethal Dose | NA |
| Combination Therapy | NA |
| Pubmed ID | 22622363 |
| Year of Publication | 2012 |
| 3-D Structure |  View in Jmol or Download Structure |
