Primary information |
---|
ID | 1132 |
Peptide Name | Vm24 |
Sequence | AAAISCVGSPECPPKCRAQGCKNGKCMNRKCKCYYC |
Length | 36 |
Chirality | L |
N-terminal Modification | None |
C-terminal Modification | None |
Chemical Modification | None |
Linear/ Cyclic | Linear |
Nature | Natural |
Source of Origin | Vaejovis mexicanus smithi (scorpion) |
Target | Kv1.3 channels |
Mechanism of Action | Inhibits Kv1.3 channels |
In vitro/In vivo | Both |
Cell Line | COS-7, human embryonic kidney 293, tsA201, L929 and MEL cells |
Inhibition Concentartion | NA |
In vivo Model | Female Lewis rat (9-10 weeks of age) |
Assay | Proliferation assay |
Lethal Dose | NA |
Combination Therapy | NA |
Pubmed ID | 22622363 |
Year of Publication | 2012 |
3-D Structure | View in Jmol or Download Structure |