| Primary information |
|---|
| ID | 1051 |
| Peptide Name | Vm24 |
| Sequence | AAAISCVGSPECPPKCRAQGCKNGKCMNRKCKCYYC |
| Length | 36 |
| Chirality | L |
| N-terminal Modification | None |
| C-terminal Modification | Amidation |
| Chemical Modification | Four Disulfide bridges (between Cys6 and Cys26, Cys12 and Cys31, Cys16 and Cys33, and Cys21 and Cys36) |
| Linear/ Cyclic | Linear |
| Nature | Natural |
| Source of Origin | venom of the Mexican scorpion Vaejovis mexicanus smithi |
| Target | K+ channel |
| Mechanism of Action | Remarkable blocking potency and selectivity for Kv1.3 channels |
| In vitro/In vivo | Both |
| Cell Line | Mononuclear cells from human peripheral venous blood |
| Inhibition Concentartion | 90% inhibition achieved at 100pM |
| In vivo Model | Mouse model |
| Assay | Lethality test |
| Lethal Dose | No toxicity for 50 to 200 μg of protein per mouse (20 g body weight) |
| Combination Therapy | NA |
| Pubmed ID | 22540187 |
| Year of Publication | 2012 |
| 3-D Structure | NA |
