| Primary information |
|---|
| ID | 1052 |
| Peptide Name | Margatoxin |
| Sequence | TIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH |
| Length | 39 |
| Chirality | L |
| N-terminal Modification | None |
| C-terminal Modification | None |
| Chemical Modification | None |
| Linear/ Cyclic | Linear |
| Nature | Natural |
| Source of Origin | Purified from venom of the scorpion Centruroides margaritatus |
| Target | Kv1.3 channel |
| Mechanism of Action | Inhibit both Th1 and Th2 cytokine production |
| In vitro/In vivo | NA |
| Cell Line | NA |
| Inhibition Concentartion | NA |
| In vivo Model | NA |
| Assay | NA |
| Lethal Dose | NA |
| Combination Therapy | NA |
| Pubmed ID | 12747950 |
| Year of Publication | 2003 |
| 3-D Structure |  View in Jmol or Download Structure |
