| Primary information |
|---|
| ID | 1061 |
| Peptide Name | Charybdotoxin (ChTX) |
| Sequence | EFTNVSCTTSKECWSVCQRLHNTSRGKCMNKKCRCYS |
| Length | 37 |
| Chirality | L |
| N-terminal Modification | None |
| C-terminal Modification | None |
| Chemical Modification | None |
| Linear/ Cyclic | Linear |
| Nature | Natural |
| Source of Origin | Isolated from venom of the old world scorpion Leiurusguinqwstriutus var. hebraeus |
| Target | Kv1.3 channels |
| Mechanism of Action | Inhibit high conductance, Ca2+- activated K+ (Maxi-K) channel |
| In vitro/In vivo | In vitro |
| Cell Line | Human peripheral T-Lymphocytes, rat brain synaptic plasma membrane vesicles, bovine aortic sarcolemmal membrane vesicle |
| Inhibition Concentartion | NA |
| In vivo Model | NA |
| Assay | competition binding with Kv1.4 ((Potassium channel) |
| Lethal Dose | NA |
| Combination Therapy | NA |
| Pubmed ID | 8360176 |
| Year of Publication | 1993 |
| 3-D Structure |  View in Jmol or Download Structure |
