| Primary information |
|---|
| ID | 1001 |
| Peptide Name | Vm24 |
| Sequence | AAAISCVGSPECPPKCRAQGCKNGKCMNRKCKCYYC |
| Length | 36 |
| Chirality | L |
| N-terminal Modification | None |
| C-terminal Modification | Amidation |
| Chemical Modification | Cross linked by eight cysteines (between Cys6 and Cys26, Cys12 and Cys31, Cys16 and Cys33, and Cys21 and Cys36) (Disulphide linkage) |
| Linear/ Cyclic | Linear |
| Nature | Natural |
| Source of Origin | Venom of the Mexican scorpion Vaejovis mexicanus smithi |
| Target | Block Kv1.3 channels with high affinity, an estimated Kd of 2.9 pM |
| Mechanism of Action | Inhibits T Cell Proliferation, CD25 Expression, and Ca2+ Signaling In Vitro and Suppresses DTH Reactions In Vivo |
| In vitro/In vivo | Both |
| Cell Line | Human peripheral T Cells, COS-7, human embryonic kidney 293, tsA201, L929, and MEL cells |
| Inhibition Concentartion | NA |
| In vivo Model | Female Lewis rats (9-10 weeks of age) |
| Assay | T cell Proliferation assays |
| Lethal Dose | NA |
| Combination Therapy | NA |
| Pubmed ID | 22622363 |
| Year of Publication | 2012 |
| 3-D Structure | NA |
