Primary information |
---|
ID | 1014 |
Peptide Name | OSK1 (α-KTx3.7) |
Sequence | GVIINVKCKISRQCLEPCKKAGMRFGKCMNGKCHCTPK |
Length | 38 |
Chirality | L |
N-terminal Modification | None |
C-terminal Modification | None |
Chemical Modification | Three- Disulphide-bridge C1-C4, C2-C5 and C3-C6) |
Linear/ Cyclic | Linear |
Nature | Natural |
Source of Origin | Venom of the central Asian scorpion Orthochirus scrobiculosus |
Target | Kv 1.1, Kv 1.2 and Kv 1.3 channel and also Ca2+ -activated KCa 3.1 channel |
Mechanism of Action | Potent blocker of three different Kv channel types and a moderate blocker of Ca2+ -activated KCa 3.1 channel |
In vitro/In vivo | Both |
Cell Line | L929 and MEL (murine erythroleukaemia), COS-7 cells, tsA cell line, LTK-cells (lacking leucocyte tyrosine kinase), CHL (Chinese-hamster lung) cells, HEK-293 (human embryonic kidney) cells |
Inhibition Concentartion | 225±10 nM for Kca 3.1 |
In vivo Model | C57/BL6 mice |
Assay | Neurotoxicity of peptide, Pharmacological activity on various K+ (Potassium) channel |
Lethal Dose | 2.5 (μg/kg of mice) |
Combination Therapy | NA |
Pubmed ID | 15588251 |
Year of Publication | 2005 |
3-D Structure | NA |