| Primary information |
|---|
| ID | 1121 |
| Peptide Name | Charybdotoxin (Venom peptide) |
| Sequence | XFTNVSCTTSKECWSVCQRLHNTSRGKCMNKKCRCYS |
| Length | 37 |
| Chirality | L |
| N-terminal Modification | None |
| C-terminal Modification | None |
| Chemical Modification | X=PyroGlutamic acid |
| Linear/ Cyclic | Linear |
| Nature | Natural |
| Source of Origin | Leiurus quinquestriatus hebraeus (scorpion) |
| Target | K+ (potassium) channel |
| Mechanism of Action | Potassium channel blocker |
| In vitro/In vivo | In vitro |
| Cell Line | NA |
| Inhibition Concentartion | NA |
| In vivo Model | NA |
| Assay | NA |
| Lethal Dose | NA |
| Combination Therapy | NA |
| Pubmed ID | 24333193 |
| Year of Publication | 2014 |
| 3-D Structure | NA |
