Primary information |
---|
ID | 1125 |
Peptide Name | Iberiotoxin (Venom peptide) |
Sequence | XFTDVDCSVSKECWSVCKDLFGVDRGKCMGKKCRCYQ |
Length | 37 |
Chirality | L |
N-terminal Modification | None |
C-terminal Modification | None |
Chemical Modification | X=Pyroglutamic acid and disulfile linkage at Disulfide bridges: Cys7 - Cys28, Cys13 - Cys33, Cys17 - Cys35 |
Linear/ Cyclic | Linear |
Nature | Natural |
Source of Origin | Buthus tamulus (scorpion) |
Target | Blocker of several BK channels |
Mechanism of Action | Bloackion channels |
In vitro/In vivo | Both |
Cell Line | NA |
Inhibition Concentartion | NA |
In vivo Model | NA |
Assay | NA |
Lethal Dose | NA |
Combination Therapy | NA |
Pubmed ID | 24333193 |
Year of Publication | 2014 |
3-D Structure | NA |