Primary information |
---|
ID | 1053 |
Peptide Name | Margatoxin |
Sequence | TIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH |
Length | 39 |
Chirality | L |
N-terminal Modification | None |
C-terminal Modification | None |
Chemical Modification | None |
Linear/ Cyclic | Linear |
Nature | Synthetic |
Source of Origin | Recombinantnt was made by expressing the synthetic cDNA in Escherichia coli |
Target | Kv1.3 channel |
Mechanism of Action | Inhibit both Th1 and Th2 cytokine production |
In vitro/In vivo | Both |
Cell Line | Human peripheral blood mononuclear cells (PBMC), Purified T cells, Human monocytes, Human monocytic cell line, THP-1 |
Inhibition Concentartion | 0.013 nM for IL-2 when stimulation with PMA and ionomycin |
In vivo Model | Mini swine model |
Assay | Proliferation asaay, detection of intracellular cytokines, Antibody-dependent cellular cytotoxicity assay |
Lethal Dose | NA |
Combination Therapy | NA |
Pubmed ID | 12747950 |
Year of Publication | 2003 |
3-D Structure | View in Jmol or Download Structure |