| Primary information |
|---|
| ID | 1058 |
| Peptide Name | Margatoxin |
| Sequence | TIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH |
| Length | 39 |
| Chirality | L |
| N-terminal Modification | None |
| C-terminal Modification | None |
| Chemical Modification | None |
| Linear/ Cyclic | Linear |
| Nature | Synthetic |
| Source of Origin | Recombinantnt was made by expressing the synthetic cDNA in Escherichia coli |
| Target | Kv1.3 channel |
| Mechanism of Action | Inhibit both Th1 and Th2 cytokine production |
| In vitro/In vivo | Both |
| Cell Line | Human peripheral blood mononuclear cells (PBMC), Purified T cells, Human monocytes, Human monocytic cell line, THP-6 |
| Inhibition Concentartion | 0.5 nM anti-CD3 mediated redirected cytolysis of CD8(+) T cells |
| In vivo Model | Mini swine model |
| Assay | Proliferation asaay, detection of intracellular cytokines, Antibody-dependent cellular cytotoxicity assay |
| Lethal Dose | NA |
| Combination Therapy | NA |
| Pubmed ID | 12747950 |
| Year of Publication | 2003 |
| 3-D Structure |  View in Jmol or Download Structure |
