| 1037 | Colutellin A | VISIIPV | 7 | L | None | None | None | Cyclic | Natural | Endophytic fungus Colletotrichum dematium | Inhibit IL-2 production by activated CD4+ T-cells | Inhibiting the calcineurin pathway | Both | Peripheral blood mononuclear cells (PBMCs) | 167.3±0.38 nM for CD4+ T cell activation of IL-2 production | C57/B6 mice | MIC assay, Immunosuppression and toxicity test | MIC of 3.6 mg/ml (48 h) against Botrytis cinerea and Sclerotinia sclerotiorum. | NA | 18599825 | 2008 |
| 1042 | ISP region (Mutant D105) | EVVLQNRRGLDLLTAEQGGICLALQEKCCFYANKS | 35 | L | None | None | None | Linear | Protein Derived | Within the transmembrane (TM) protein of Mason-Pfizer monkey virus | T-cell and B-cell | Immunosuppressive effect on both T-cell and B-cell mitogenic response | In vitro | HeLa, COS-1, CV-1and BHK cells | NA | NA | NA | NA | NA | 1316462 | 1992 |
| 1043 | ISP region (Mutant D33) | LQNRRGLDLLT | 11 | L | None | None | None | Linear | Protein Derived | Within the transmembrane (TM) protein of Mason-Pfizer monkey virus | T-cell and B-cell | Immunosuppressive effect on both T-cell and B-cell mitogenic response | In vitro | HeLa, COS-1, CV-1and BHK cells | NA | NA | NA | NA | NA | 1316462 | 1992 |
| 1045 | Cyclolinopeptide A (CLA) | VPPFFLIIL | 9 | L | None | None | None | Cyclic | Natural | isolated from linseed oil | Cyclophilin A, IL-1α, IL-2 | it binds to cyclophilin A and inhibits the action of Interleukin-1-alpha and Interleukin-2 | Both | SRBC (Sheep red blood cells) | dose combinations: 0.1 mg/ml of CLA and 0.25 mM of MTX exhibited suppressive, synergistic action | 12-week-old BALB/c female mice | Secondary humoral immune response | NA | Methotrexate (MTX) | 21839548 | 2011 |
| 1050 | CLA analogue5 | LVPPFFLII | 9 | L | None | None | None | Linear | Synthetic | Analog of cyclolinopeptide A (CLA) | NA | NA | Both | SRBC (Sheep red blood cells) | NA | 12-week-old BALB/c female mice | Secondary humoral immune response | NA | NA | 21839548 | 2011 |
| 1052 | Margatoxin | TIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH | 39 | L | None | None | None | Linear | Natural | Purified from venom of the scorpion Centruroides margaritatus | Kv1.3 channel | Inhibit both Th1 and Th2 cytokine production | NA | NA | NA | NA | NA | NA | NA | 12747950 | 2003 |
| 1053 | Margatoxin | TIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH | 39 | L | None | None | None | Linear | Synthetic | Recombinantnt was made by expressing the synthetic cDNA in Escherichia coli | Kv1.3 channel | Inhibit both Th1 and Th2 cytokine production | Both | Human peripheral blood mononuclear cells (PBMC), Purified T cells, Human monocytes, Human monocytic cell line, THP-1 | 0.013 nM for IL-2 when stimulation with PMA and ionomycin | Mini swine model | Proliferation asaay, detection of intracellular cytokines, Antibody-dependent cellular cytotoxicity assay | NA | NA | 12747950 | 2003 |
| 1054 | Margatoxin | TIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH | 39 | L | None | None | None | Linear | Synthetic | Recombinantnt was made by expressing the synthetic cDNA in Escherichia coli | Kv1.3 channel | Inhibit both Th1 and Th2 cytokine production | Both | Human peripheral blood mononuclear cells (PBMC), Purified T cells, Human monocytes, Human monocytic cell line, THP-2 | 0.016 nM for IL-4 when stimulation with PMA and ionomycin | Mini swine model | Proliferation asaay, detection of intracellular cytokines, Antibody-dependent cellular cytotoxicity assay | NA | NA | 12747950 | 2003 |
| 1055 | Margatoxin | TIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH | 39 | L | None | None | None | Linear | Synthetic | Recombinantnt was made by expressing the synthetic cDNA in Escherichia coli | Kv1.3 channel | Inhibit both Th1 and Th2 cytokine production | Both | Human peripheral blood mononuclear cells (PBMC), Purified T cells, Human monocytes, Human monocytic cell line, THP-3 | 0.5 nM for IL-2 production when stimulated with a-CD3 and VCAM-1 | Mini swine model | Proliferation asaay, detection of intracellular cytokines, Antibody-dependent cellular cytotoxicity assay | NA | NA | 12747950 | 2003 |
| 1056 | Margatoxin | TIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH | 39 | L | None | None | None | Linear | Synthetic | Recombinantnt was made by expressing the synthetic cDNA in Escherichia coli | Kv1.3 channel | Inhibit both Th1 and Th2 cytokine production | Both | Human peripheral blood mononuclear cells (PBMC), Purified T cells, Human monocytes, Human monocytic cell line, THP-4 | 0.13 nM for IL-4 production when stimulated with a-CD3 and VCAM-1 | Mini swine model | Proliferation asaay, detection of intracellular cytokines, Antibody-dependent cellular cytotoxicity assay | NA | NA | 12747950 | 2003 |
| 1057 | Margatoxin | TIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH | 39 | L | None | None | None | Linear | Synthetic | Recombinantnt was made by expressing the synthetic cDNA in Escherichia coli | Kv1.3 channel | Inhibit both Th1 and Th2 cytokine production | Both | Human peripheral blood mononuclear cells (PBMC), Purified T cells, Human monocytes, Human monocytic cell line, THP-5 | 4.9 nM for a-CD3/VCAM-1 induced proliferation | Mini swine model | Proliferation asaay, detection of intracellular cytokines, Antibody-dependent cellular cytotoxicity assay | NA | NA | 12747950 | 2003 |
| 1058 | Margatoxin | TIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH | 39 | L | None | None | None | Linear | Synthetic | Recombinantnt was made by expressing the synthetic cDNA in Escherichia coli | Kv1.3 channel | Inhibit both Th1 and Th2 cytokine production | Both | Human peripheral blood mononuclear cells (PBMC), Purified T cells, Human monocytes, Human monocytic cell line, THP-6 | 0.5 nM anti-CD3 mediated redirected cytolysis of CD8(+) T cells | Mini swine model | Proliferation asaay, detection of intracellular cytokines, Antibody-dependent cellular cytotoxicity assay | NA | NA | 12747950 | 2003 |
| 1059 | Margatoxin | TIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH | 39 | L | None | None | None | Linear | Synthetic | Recombinantnt was made by expressing the synthetic cDNA in Escherichia coli | Kv1.3 channel | Inhibit both Th1 and Th2 cytokine production | Both | Human peripheral blood mononuclear cells (PBMC), Purified T cells, Human monocytes, Human monocytic cell line, THP-7 | 0.5 nM anti-CD3 mediated redirected cytolysis of T cells | Mini swine model | Proliferation asaay, detection of intracellular cytokines, Antibody-dependent cellular cytotoxicity assay | NA | NA | 12747950 | 2003 |
| 1060 | Margatoxin | TIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH | 39 | L | None | None | None | Linear | Natural | From venom of the new world scorpion Centruroides margaritatus | Kv1.3 channels | Blocks with high affinity and specificity the Kv1.3 channel | In vitro | Human peripheral T-Lymphocytes, rat brain synaptic plasma membrane vesicles, bovine aortic sarcolemmal membrane vesicle | 36 pM | NA | competition binding with Kv1.3 (Potassium channel) | NA | NA | 8360176 | 1993 |
| 1061 | Charybdotoxin (ChTX) | EFTNVSCTTSKECWSVCQRLHNTSRGKCMNKKCRCYS | 37 | L | None | None | None | Linear | Natural | Isolated from venom of the old world scorpion Leiurusguinqwstriutus var. hebraeus | Kv1.3 channels | Inhibit high conductance, Ca2+- activated K+ (Maxi-K) channel | In vitro | Human peripheral T-Lymphocytes, rat brain synaptic plasma membrane vesicles, bovine aortic sarcolemmal membrane vesicle | NA | NA | competition binding with Kv1.4 ((Potassium channel) | NA | NA | 8360176 | 1993 |
| 1062 | Charybdotoxin (ChTX) | EFTNVSCTTSKECWSVCQRLHNTSRGKCMNKKCRCYS | 37 | L | None | None | None | Linear | Natural | Venom of the scorpion Leiurusquin questriatus var. hebraeus | K+ channels | Potent selective block of apamin-insensitive Ca2+- activated K+ channels | In vitro | GH3 pitutary cells and aortic smooth muscle | NA | NA | NA | NA | NA | 2453055 | 1988 |
| 1064 | Antamanide | VPPAFFPPFF | 10 | L | None | None | None | Cyclic | Natural | Isolated from the poisonous mushroom Amanita phalloides | Peptidyl-prolyl cis-trans isomerase CyP-D | Inhibit mitochondrial permeability transition pore | Both | HeLa Cells | NA | C57BL/6 mice | Cell Viability assay, Ca2+ retention capacity assay | NA | NA | 21297983 | 2011 |
| 1065 | Cyclolinopeptide A (CLA) | VPPFFLIIL | 9 | L | None | None | None | Cyclic | Synthetic | NA | NA | Inhibition of the action of interleukin-1 and interleukin-2 | Both | SRBC (sheep red blood cells) | NA | CBA/Iiw mice 8-10 weeks | Humoral immune response test,PFC (plaque froming cell) test, DTH (delayed type hypersensitivity) test | NA | NA | 8441706 | 1992 |
| 1066 | Antamanide | VPPAFFPPFF | 10 | L | None | None | None | Cyclic | Natural | Isolated from the mushroom Amanita phalloides | NA | Not investigated | Both | SRBC (sheep red blood cells) | NA | CBA/Iiw mice 8-10 weeks | Humoral immune response test,PFC (plaque froming cell) test, DTH (delayed type hypersensitivity) test | NA | NA | 8441706 | 1992 |
| 1067 | Cycloamanide A (CyA A) | VFFAGP | 6 | L | None | None | None | Cyclic | Natural | Isolated from the mushroom Amanita phalloides | NA | Not investigated | Both | SRBC (sheep red blood cells) | NA | CBA/Iiw mice 8-10 weeks | Humoral immune response test,PFC (plaque froming cell) test, DTH (delayed type hypersensitivity) test | NA | NA | 8441706 | 1992 |
| 1068 | [D-Phe3]CyA A | VFfAGP | 6 | Mix | None | None | None | Cyclic | Synthetic | NA | NA | Not investigated | Both | SRBC (sheep red blood cells) | NA | CBA/Iiw mice 8-10 weeks | Humoral immune response test,PFC (plaque froming cell) test, DTH (delayed type hypersensitivity) test | NA | NA | 8441706 | 1992 |
| 1069 | Cycloamanide B (CyA B) | FFFPIPS | 7 | L | None | None | None | Cyclic | Natural | Isolated from the mushroom Amanita phalloides | NA | Not investigated | Both | SRBC (sheep red blood cells) | NA | CBA/Iiw mice 8-10 weeks | Humoral immune response test,PFC (plaque froming cell) test, DTH (delayed type hypersensitivity) test | NA | NA | 8441706 | 1992 |
| 1070 | [D-Ser]CyA B | FFFPIPs | 7 | Mix | None | None | None | Cyclic | Synthetic | NA | NA | Not investigated | Both | SRBC (sheep red blood cells) | NA | CBA/Iiw mice 8-10 weeks | Humoral immune response test,PFC (plaque froming cell) test, DTH (delayed type hypersensitivity) test | NA | NA | 8441706 | 1992 |
| 1073 | Retro-[D-Phe3]CyA A | fFVPGA | 6 | Mix | None | None | None | Cyclic | Synthetic | NA | NA | Not investigated | Both | SRBC (sheep red blood cells) | NA | CBA/Iiw mice 8-10 weeks | Humoral immune response test,PFC (plaque froming cell) test, DTH (delayed type hypersensitivity) test | NA | NA | 8441706 | 1992 |
| 1074 | Retro-[D-Phe3]CyA A | fFVPGA | 6 | Mix | None | None | None | Linear | Synthetic | NA | NA | Not investigated | Both | SRBC (sheep red blood cells) | NA | CBA/Iiw mice 8-10 weeks | Humoral immune response test,PFC (plaque froming cell) test, DTH (delayed type hypersensitivity) test | NA | NA | 8441706 | 1992 |
| 1075 | CKS-17 | LQNRRGLDLLFLKEGGL | 17 | L | None | Conjugated to HSA (human serum albumin) | None | Linear | Synthetic | Homologous region found in the transmembrane envelope proteins of murine, feline, and human retro- viruses HTLV-1 and HTLV-2, and an endogenous C-type human retrovirus | Lymphocyte | Inhibits the Proliferation of Purified Lymphocytes | In vitro | Mononuclear Cells, Lymphocytes, Human Neutrophils, Lymphoblastoid cell line-Jurkat cell, | 10 micromolar in Lymphocyte proliferation assays | None | Lymphocyte Proliferation assay | NA | NA | 1921761 | 1991 |
| 1076 | CKS-17 | LQNRRGLDLLFLKEGGL | 17 | L | None | Conjugated to HSA (human serum albumin) | None | Linear | Synthetic | Homologous region found in the transmembrane envelope proteins of murine, feline, and human retro- viruses HTLV-1 and HTLV-2, and an endogenous C-type human retrovirus | Protein Kinase C | Inhibits Protein Kinase C activity | In vitro | Human Neutrophils, Lymphoblastoid cell line-Jurkat cell | 3 micromolar in the in vitro protein kinase C assay | None | Protein kinase assay | NA | NA | 1921761 | 1991 |
| 1077 | CKS-17 | LQNRRGLDLLFLKEGGL | 17 | L | None | Conjugated to BSA (bovine serum albumin) | None | Linear | Synthetic | Homologous region found in the transmembrane envelope proteins of murine, feline, and human retro- viruses HTLV-1 and HTLV-2, and an endogenous C-type human retrovirus | Protein Kinase C | inhibition of IL-1-mediated responses, due to inactivation of PKC. inactivates PKC directly without competing with its cofactors. | In vitro | Human Neutrophils, Lymphoblastoid cell line-Jurkat cell | 3 micromolar in the in vitro protein kinase C assay | None | Protein kinase assay | NA | NA | 1921761 | 1991 |
| 1078 | CSK-17 | LQNRRGLDLLFLKEGGL | 18 | L | None | None | None | Linear | Synthetic | NA | NA | Inhibition of human Lymphocyte | NA | NA | NA | NA | NA | NA | NA | 2421920 | 1986 |
| 1079 | MPMV | EVVLQNRRGLDLLTAEQGGICLALQEKCCFYANKS | 35 | L | None | None | None | Linear | Protein Derived | From the envelope protein of Mason-Pfizer monkey virus | NA | Inhibition of human Lymphocyte | NA | NA | NA | NA | NA | NA | NA | 2421920 | 1986 |
| 1080 | REV-A | EVVLQNRRGLDLLTAEQGGICLALQEKCCFYANKS | 35 | L | None | None | None | Linear | Protein Derived | From the transmembrane protein of reticuloendotheliosis associated virus | NA | Inhibition of human Lymphocyte | NA | NA | NA | NA | NA | NA | NA | 2421920 | 1986 |
| 1081 | FeLV | EVVLQNRRGLDILFLQEGGLCAALKEECCFYADHT | 35 | L | None | None | None | Linear | Protein Derived | From the transmembrane protein of feline leukemia virus | NA | Inhibition of human Lymphocyte | NA | NA | NA | NA | NA | NA | NA | 2421920 | 1986 |
| 1082 | Mo-MLV | EVVLQNRRGLDLLFLKEGGLCAALKEECCFYADHT | 35 | L | None | None | None | Linear | Protein Derived | From the transmembrane protein of Moloney murine leukemia virus | NA | Inhibition of human Lymphocyte | NA | NA | NA | NA | NA | NA | NA | 2421920 | 1986 |
| 1083 | RSV | HAVLQNRAAIDFLLLAHGHGCEDVAGMCCFNLSDH | 35 | L | None | None | None | Linear | Protein Derived | From the transmembrane protein of Rous Sarcoma Virus | NA | Inhibition of human Lymphocyte | NA | NA | NA | NA | NA | NA | NA | 2421920 | 1986 |
| 1084 | HTLV-1 | QYAAQNRRGLDLLFWEQGGLCKALQEQCRFPNITN | 35 | L | None | None | None | Linear | Protein Derived | From the transmembrane protein of human T cell leukemia viruses type 1 | NA | Inhibition of human Lymphocyte | NA | NA | NA | NA | NA | NA | NA | 2421920 | 1986 |
| 1085 | HTLV-2 | QYAAQNRRGLDLLFWEQGGLCKALQEQCCFLNISN | 35 | L | None | None | None | Linear | Protein Derived | From the transmembrane protein of human T cell leukemia viruses type 2 | NA | Inhibition of human Lymphocyte | NA | NA | NA | NA | NA | NA | NA | 2421920 | 1986 |
| 1086 | Ac1-9 | ASQKRPSQR | 9 | L | Acetylation | None | None | Linear | Protein Derived | From myelin basic protein | IL-10 and IL-2 | peptide-induced regulatory cells suppress the response of naive T cells and leads to the generation of IL-10-secreting regulatory cells | Both | purified T cells | NA | Tg4 transgenic mouse | CD4 T cell Proliferation assays, Cytokine protein levels assays | NA | NA | 12538682 | 2003 |
| 1087 | MHC-binding analog (Ac1-9[4Y]) | ASQYRPSQR | 9 | L | Acetylation | None | None | Linear | Synthetic | Analog of Ac1-9 | IL-10 and IL-3 | peptide-induced regulatory cells suppress the response of naive T cells and leads to the generation of IL-10-secreting regulatory cells | Both | purified T cells | NA | Tg4 transgenic mouse | CD4 T cell Proliferation assays, Cytokine protein levels assays | NA | NA | 12538682 | 2003 |
| 1088 | ISU-peptide | LQARILAVERYLKDQQL | 17 | L | None | None | None | Linear | Protein Derived | HIV-1 isolate HXB2 | IL-2 | HIV env 583-599 conjugated to a carrier protein to inhibit the cytopathic effect of HIV-1. This inhibition of vims replication may be due to blocking of a secondary receptor, to inhibition of target cell proliferation preventing virus replication or to both effects | Both | Murine CTL-6, human T-cell lines MT4, Molt4/clone 8 | NA | Balb/c mice | Lymphocyte Proliferation assays, cytopathogenicity assay | NA | NA | 7986401 | 1994 |
| 1091 | Transforming growth factor beta 1 (TGFβ1) | not available | 0 | L | None | None | None | Linear | Protein Derived | Human melanoma cell line | IL-7 | The immunosuppressive peptide TGFβ1 was inhibited in a human melanoma cell line transduced with IL-7 | Both | M- 14 and M-24 | NA | Congenitally athymic (nu/nu) BALB/c mice | TGFβ1 bioassay | NA | NA | 8260705 | 1993 |
| 1092 | CKS-17 | LQNRRGLD | 8 | L | None | None | None | Linear | Protein Derived | murine leukemia virus pl5E TM protein | NA | Unknown | In vitro | Normal brain tissue, kidney, lymphocytes, cultured embryonic lung cells, rhabdomyosarcoma cell line | NA | NA | Evolutionary conservation and PCR-based assay | NA | NA | 8419641 | 1992 |
| 1093 | HLA-A2 (56-69) | QFVRFDSDAASQRM | 14 | L | None | None | None | Linear | Protein Derived | MHC molecule | NA | NA | Both | NA | NA | LEW rat | Graft transplation assay | NA | NA | 8573307 | 1995 |
| 1094 | HLA-A2 (60-84) | FDSDAASQRMEPRAPWIEQEGPEYW | 25 | L | None | None | None | Linear | Protein Derived | MHC molecule | NA | NA | Both | NA | NA | LEW rat | Graft transplation assay | NA | NA | 8573307 | 1995 |
| 1095 | HLA-A2 (98-113) | HRVDLGTLRGYYNQSE | 16 | L | None | None | None | Linear | Protein Derived | MHC molecule | NA | NA | Both | NA | NA | LEW rat | Graft transplation assay | NA | NA | 8573307 | 1995 |
| 1096 | HLA-A2 (222-235) | EATLRCWALSFYPA | 14 | L | None | None | None | Linear | Protein Derived | MHC molecule | NA | NA | Both | NA | NA | LEW rat | Graft transplation assay | NA | NA | 8573307 | 1995 |
| 1097 | HLA-B2702 (75-84) | WIEQEGPEYW | 10 | L | None | None | None | Linear | Protein Derived | MHC molecule | NA | NA | Both | NA | NA | LEW rat | T cell assay | NA | NA | 8573307 | 1995 |
| 1098 | HLA-B38 (75-84) | WIEQEGPEYW | 10 | L | None | None | None | Linear | Protein Derived | MHC molecule | NA | NA | Both | NA | NA | LEW rat | Graft transplation assay | NA | NA | 8573307 | 1995 |
| 1099 | gp41 portion of gp160 peptide | LSVWGIRQLRARLLALE | 17 | L | None | None | None | Linear | Protein Derived | GP160 protein of HIV | NA | Induced progressive inhibition of PHA-induced lymphocyte proliferation | Both | CTLL-2, murine IL-2-dependent cell line | NA | Balb/c mice, 4-12 months old | Proliferation assay | NA | Interferon α, PGE 2 | 8582788 | 1995 |
| 1100 | Recombinant Soluble HIV-I GP41 (539-684) | VQARQLLSGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARILAVERYLKDQQLLGIWGCSGKLICTTAVPWNASWSNKSLEQIWNNMTWMEWDREINNYTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWFNITNWLWYIKL | 146 | L | None | None | None | Linear | Protein Derived | HIV-l (derived from clone BH10) | mitogen (Con A, PHA) | Inhibits mitogen-(Con A and PHA) and antigen-(tetanus toxaid)-induced lymphocyte proliferation. It also inhibits the spontaneous cell proliferation of human T, B and monocytic cell lines. | In vitro | Human H9, Jurkat, Raji, Daudi. U937 and HEF cell lines | 8micromolar | NA | BrdU-Labeling and Detection-Kit | NA | NA | 8847089 | 1995 |
| 1101 | Recombinant Soluble HIV-2 GP36 (565-581) | LRLTVWGTKNLQARVTA | 17 | L | None | None | None | Linear | Protein Derived | HIV-2 (derived from clone ROD) | Con A | Inhibits Con A and protein kinase C (PKC) activity | In vitro | Human H9, Jurkat, Raji, Daudi. U937 and HEF cell lines | NA | NA | BrdU-Labeling and Detection-Kit | NA | NA | 8847089 | 1995 |
