| Primary information |
|---|
| ID | 1100 |
| Peptide Name | Recombinant Soluble HIV-I GP41 (539-684) |
| Sequence | VQARQLLSGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARILAVERYLKDQQLLGIWGCSGKLICTTAVPWNASWSNKSLEQIWNNMTWMEWDREINNYTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWFNITNWLWYIKL |
| Length | 146 |
| Chirality | L |
| N-terminal Modification | None |
| C-terminal Modification | None |
| Chemical Modification | None |
| Linear/ Cyclic | Linear |
| Nature | Protein Derived |
| Source of Origin | HIV-l (derived from clone BH10) |
| Target | mitogen (Con A, PHA) |
| Mechanism of Action | Inhibits mitogen-(Con A and PHA) and antigen-(tetanus toxaid)-induced lymphocyte proliferation. It also inhibits the spontaneous cell proliferation of human T, B and monocytic cell lines. |
| In vitro/In vivo | In vitro |
| Cell Line | Human H9, Jurkat, Raji, Daudi. U937 and HEF cell lines |
| Inhibition Concentartion | 8micromolar |
| In vivo Model | NA |
| Assay | BrdU-Labeling and Detection-Kit |
| Lethal Dose | NA |
| Combination Therapy | NA |
| Pubmed ID | 8847089 |
| Year of Publication | 1995 |
| 3-D Structure |  View in Jmol or Download Structure |
