| Primary information |
|---|
| ID | 1079 |
| Peptide Name | MPMV |
| Sequence | EVVLQNRRGLDLLTAEQGGICLALQEKCCFYANKS |
| Length | 35 |
| Chirality | L |
| N-terminal Modification | None |
| C-terminal Modification | None |
| Chemical Modification | None |
| Linear/ Cyclic | Linear |
| Nature | Protein Derived |
| Source of Origin | From the envelope protein of Mason-Pfizer monkey virus |
| Target | NA |
| Mechanism of Action | Inhibition of human Lymphocyte |
| In vitro/In vivo | NA |
| Cell Line | NA |
| Inhibition Concentartion | NA |
| In vivo Model | NA |
| Assay | NA |
| Lethal Dose | NA |
| Combination Therapy | NA |
| Pubmed ID | 2421920 |
| Year of Publication | 1986 |
| 3-D Structure |  View in Jmol or Download Structure |
