Primary information |
---|
ID | 1042 |
Peptide Name | ISP region (Mutant D105) |
Sequence | EVVLQNRRGLDLLTAEQGGICLALQEKCCFYANKS |
Length | 35 |
Chirality | L |
N-terminal Modification | None |
C-terminal Modification | None |
Chemical Modification | None |
Linear/ Cyclic | Linear |
Nature | Protein Derived |
Source of Origin | Within the transmembrane (TM) protein of Mason-Pfizer monkey virus |
Target | T-cell and B-cell |
Mechanism of Action | Immunosuppressive effect on both T-cell and B-cell mitogenic response |
In vitro/In vivo | In vitro |
Cell Line | HeLa, COS-1, CV-1and BHK cells |
Inhibition Concentartion | NA |
In vivo Model | NA |
Assay | NA |
Lethal Dose | NA |
Combination Therapy | NA |
Pubmed ID | 1316462 |
Year of Publication | 1992 |
3-D Structure | View in Jmol or Download Structure |