Primary information |
---|
ID | 1082 |
Peptide Name | Mo-MLV |
Sequence | EVVLQNRRGLDLLFLKEGGLCAALKEECCFYADHT |
Length | 35 |
Chirality | L |
N-terminal Modification | None |
C-terminal Modification | None |
Chemical Modification | None |
Linear/ Cyclic | Linear |
Nature | Protein Derived |
Source of Origin | From the transmembrane protein of Moloney murine leukemia virus |
Target | NA |
Mechanism of Action | Inhibition of human Lymphocyte |
In vitro/In vivo | NA |
Cell Line | NA |
Inhibition Concentartion | NA |
In vivo Model | NA |
Assay | NA |
Lethal Dose | NA |
Combination Therapy | NA |
Pubmed ID | 2421920 |
Year of Publication | 1986 |
3-D Structure | View in Jmol or Download Structure |