Browse result page of AntiTbPdb
The total number entries retrieved from this search are 434
| ID | Name | Sequence | N-Terminal Modification | C-Terminal Modification | Chemical Modification | Linear/Cyclic | Length | Chirality | Nature | Source | Origin | Species | Strain | Inhibition Concentration | In vitro/ In vivo | Cell Line | Intracellular Inhibition | Cytotoxicity | Animal Model | Effective Dose in model organism | Immune Responce | Mechanism of Action | Target | Combination Therapy | Other Activities | Year of Publication | Pubmed ID/ Patent No. |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| antitb_1722 | Human neutrophil peptide (HNP-1) | ACYCRIPACIAGERRYGTCIYQGRLWAFCC | Free | Free | Disulphide linkage between cys2-cys30, cys4-cys19,cys9-cys29 | Cyclic | 30 | L | Cationic | Natural | Human neutrophil | Mycobacterium avium- mycobacterium intracellularae | Mycobacterium avium- mycobacterium intracellularae strain 475049 | Reduction in CFU/well 32.5 ± 10.7 at peptide concentration 50μg/ml | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 1992 | 1398982 |
| antitb_1776 | Sesquin | KTCENLADTY | Free | Free | None | Linear | 10 | L | Cationic | Natural | Isolated from ground beans (Vigna sesquipedalis cv. ‘Ground Bean’) | Mycobacterium phlei | Mycobacterium phlei | IC50 = 87 ± 5 µM | In vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial, Antifungal | 2005 | 15949629 |
| antitb_1777 | Mitogenic defensin | MEKKSFAGLCFLFLVLFVAQECVLQTEAKTCENLADTFRGPCFATGNCDDHCKNKEHLLRGRCRDDFRCWCTRNC | Free | Free | Disulfide linkage | Cyclic | 75 | L | Cationic | Natural | From the seeds of white cloud beans (Phaseolus vulgaris cv. ‘white cloud bean’) | Mycobacterium phlei | Mycobacterium phlei | IC50 = 86 ± 6 µM | In vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial, Antifungal | 2006 | 16687191 |
| antitb_1811 | LL- 37 | [LL-37, 37 aa] | Free | Free | None | Linear | 37 | L | Cationic | Natural | Human cells | Mycobacterium tuberculosis | Mycobacterium tuberculosis strain H37Rv | MIC = 5 μM | Both | NA | NA | NA | Male BALB/c mice | a significant reduction in bacilli loads | NA | Disruption of cell wall and membrane | cell wall and membrane | NA | Antibacterial (P.aeruginosa) | 2012 | 23141114 |
| antitb_1812 | mouse CRAMP | GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ | Free | Free | None | Linear | 34 | L | Cationic | Natural | Mouse cells | Mycobacterium tuberculosis | Mycobacterium tuberculosis strain H37Rv | MIC = 4 μM | Both | NA | NA | NA | Male BALB/c mice | a significant reduction in bacilli loads | NA | Disruption of cell wall and membrane | cell wall and membrane | NA | Antibacterial (P.aeruginosa) | 2012 | 23141114 |
| antitb_1832 | Hytramycin V | (METH-Ala)-(D-Pip)-L-(D-VAL)-Pip-(D-Pip) | Free | Free | METH-ALA= Methylated alanine, D-Pip = piperazic acid moieties | Cyclic (Intrachain bond between 1-6) | 6 | Mix | NA | Natural | From Streptomyces hygroscopicus strain ECUM 14046 | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 11.3 μg/mL | In vitro | None | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial (Escherichia coli (ATCC 25922), Staphylococcus aureus (ATCC 29213), Acinetobacter baumannii (ATCC BAA-747), Enterococcus faecalis (ATCC 29212), and Pseudomonas aeruginosa (ATCC 27853) | 2013 | 24224794 |
| antitb_1833 | Hytramycin V | (METH-Ala)-(D-Pip)-L-(D-VAL)-Pip-(D-Pip) | Free | Free | METH-ALA= Methylated alanine, D-Pip = piperazic acid moieties | Cyclic (Intrachain bond between 1-6) | 6 | Mix | NA | Natural | From Streptomyces hygroscopicus strain ECUM 14046 | Mycobacterium tuberculosis | Clinical isolate, X004439 | MIC = 9.3 μg/mL | In vitro | None | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial (Escherichia coli (ATCC 25922), Staphylococcus aureus (ATCC 29213), Acinetobacter baumannii (ATCC BAA-747), Enterococcus faecalis (ATCC 29212), and Pseudomonas aeruginosa (ATCC 27853) | 2013 | 24224794 |
| antitb_1834 | Hytramycin V | (METH-Ala)-(D-Pip)-L-(D-VAL)-Pip-(D-Pip) | Free | Free | METH-ALA= Methylated alanine, D-Pip = piperazic acid moieties | Cyclic (Intrachain bond between 1-6) | 6 | Mix | NA | Natural | From Streptomyces hygroscopicus strain ECUM 14046 | Mycobacterium tuberculosis | Clinical isolate, X004244 | MIC = 16.9 μg/mL | In vitro | None | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial (Escherichia coli (ATCC 25922), Staphylococcus aureus (ATCC 29213), Acinetobacter baumannii (ATCC BAA-747), Enterococcus faecalis (ATCC 29212), and Pseudomonas aeruginosa (ATCC 27853) | 2013 | 24224794 |
| antitb_1835 | Hytramycin V | (METH-Ala)-(D-Pip)-L-(D-VAL)-Pip-(D-Pip) | Free | Free | METH-ALA= Methylated alanine, D-Pip = piperazic acid moieties | Cyclic (Intrachain bond between 1-6) | 6 | Mix | NA | Natural | From Streptomyces hygroscopicus strain ECUM 14046 | Mycobacterium tuberculosis | Clinical isolate, X005282 | MIC = 9.6 μg/mL | In vitro | None | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial (Escherichia coli (ATCC 25922), Staphylococcus aureus (ATCC 29213), Acinetobacter baumannii (ATCC BAA-747), Enterococcus faecalis (ATCC 29212), and Pseudomonas aeruginosa (ATCC 27853) | 2013 | 24224794 |
| antitb_1836 | Hytramycin V | (METH-Ala)-(D-Pip)-L-(D-VAL)-Pip-(D-Pip) | Free | Free | METH-ALA= Methylated alanine, D-Pip = piperazic acid moieties | Cyclic (Intrachain bond between 1-6) | 6 | Mix | NA | Natural | From Streptomyces hygroscopicus strain ECUM 14046 | Mycobacterium tuberculosis | Clinical isolate, X005319 | MIC = 19.2 μg/mL | In vitro | None | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial (Escherichia coli (ATCC 25922), Staphylococcus aureus (ATCC 29213), Acinetobacter baumannii (ATCC BAA-747), Enterococcus faecalis (ATCC 29212), and Pseudomonas aeruginosa (ATCC 27853) | 2013 | 24224794 |
| antitb_1837 | Hytramycin V | (METH-Ala)-(D-Pip)-L-(D-VAL)-Pip-(D-Pip) | Free | Free | METH-ALA= Methylated alanine, D-Pip = piperazic acid moieties | Cyclic (Intrachain bond between 1-6) | 6 | Mix | NA | Natural | From Streptomyces hygroscopicus strain ECUM 14046 | Mycobacterium tuberculosis | Clinical isolate, X001354 | MIC = 9.7 μg/mL | In vitro | None | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial (Escherichia coli (ATCC 25922), Staphylococcus aureus (ATCC 29213), Acinetobacter baumannii (ATCC BAA-747), Enterococcus faecalis (ATCC 29212), and Pseudomonas aeruginosa (ATCC 27853) | 2013 | 24224794 |
| antitb_1838 | Hytramycin V | (METH-Ala)-(D-Pip)-L-(D-VAL)-Pip-(D-Pip) | Free | Free | METH-ALA= Methylated alanine, D-Pip = piperazic acid moieties | Cyclic (Intrachain bond between 1-6) | 6 | Mix | NA | Natural | From Streptomyces hygroscopicus strain ECUM 14046 | Mycobacterium tuberculosis | Clinical isolate, X003899 | MIC = 22.9 μg/mL | In vitro | None | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial (Escherichia coli (ATCC 25922), Staphylococcus aureus (ATCC 29213), Acinetobacter baumannii (ATCC BAA-747), Enterococcus faecalis (ATCC 29212), and Pseudomonas aeruginosa (ATCC 27853) | 2013 | 24224794 |
| antitb_1839 | Hytramycin V | (METH-Ala)-(D-Pip)-L-(D-VAL)-Pip-(D-Pip) | Free | Free | METH-ALA= Methylated alanine, D-Pip = piperazic acid moieties | Cyclic (Intrachain bond between 1-6) | 6 | Mix | NA | Natural | From Streptomyces hygroscopicus strain ECUM 14046 | Mycobacterium tuberculosis | Mycobacterium tuberculosis resistant to streptomycin (rSM, ATCC 35820) | MIC = 11.6 μg/mL | In vitro | None | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial (Escherichia coli (ATCC 25922), Staphylococcus aureus (ATCC 29213), Acinetobacter baumannii (ATCC BAA-747), Enterococcus faecalis (ATCC 29212), and Pseudomonas aeruginosa (ATCC 27853) | 2013 | 24224794 |
| antitb_1840 | Hytramycin V | (METH-Ala)-(D-Pip)-L-(D-VAL)-Pip-(D-Pip) | Free | Free | METH-ALA= Methylated alanine, D-Pip = piperazic acid moieties | Cyclic (Intrachain bond between 1-6) | 6 | Mix | NA | Natural | From Streptomyces hygroscopicus strain ECUM 14046 | Mycobacterium tuberculosis | Mycobacterium tuberculosis resistant to rifampin (rRMP, ATCC 35838) | MIC = 9.6 μg/mL | In vitro | None | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial (Escherichia coli (ATCC 25922), Staphylococcus aureus (ATCC 29213), Acinetobacter baumannii (ATCC BAA-747), Enterococcus faecalis (ATCC 29212), and Pseudomonas aeruginosa (ATCC 27853) | 2013 | 24224794 |
| antitb_1841 | Hytramycin V | (METH-Ala)-(D-Pip)-L-(D-VAL)-Pip-(D-Pip) | Free | Free | METH-ALA= Methylated alanine, D-Pip = piperazic acid moieties | Cyclic (Intrachain bond between 1-6) | 6 | Mix | NA | Natural | From Streptomyces hygroscopicus strain ECUM 14046 | Mycobacterium tuberculosis | Mycobacterium tuberculosis resistant to kanamycin (rKM, ATCC 35827) | MIC = 12.4 μg/mL | In vitro | None | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial (Escherichia coli (ATCC 25922), Staphylococcus aureus (ATCC 29213), Acinetobacter baumannii (ATCC BAA-747), Enterococcus faecalis (ATCC 29212), and Pseudomonas aeruginosa (ATCC 27853) | 2013 | 24224794 |
| antitb_1842 | Hytramycin V | (METH-Ala)-(D-Pip)-L-(D-VAL)-Pip-(D-Pip) | Free | Free | METH-ALA= Methylated alanine, D-Pip = piperazic acid moieties | Cyclic (Intrachain bond between 1-6) | 6 | Mix | NA | Natural | From Streptomyces hygroscopicus strain ECUM 14046 | Mycobacterium tuberculosis | Mycobacterium tuberculosis resistant to isoniazid (rINH, ATCC 35822) | MIC = 12.1 μg/mL | In vitro | None | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial (Escherichia coli (ATCC 25922), Staphylococcus aureus (ATCC 29213), Acinetobacter baumannii (ATCC BAA-747), Enterococcus faecalis (ATCC 29212), and Pseudomonas aeruginosa (ATCC 27853) | 2013 | 24224794 |
| antitb_1843 | Hytramycin V | (METH-Ala)-(D-Pip)-L-(D-VAL)-Pip-(D-Pip) | Free | Free | METH-ALA= Methylated alanine, D-Pip = piperazic acid moieties | Cyclic (Intrachain bond between 1-6) | 6 | Mix | NA | Natural | From Streptomyces hygroscopicus strain ECUM 14046 | Mycobacterium tuberculosis | Mycobacterium tuberculosis resistant to cycloserine (rCS, ATCC 35826) | MIC = 20.6 μg/mL | In vitro | None | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial (Escherichia coli (ATCC 25922), Staphylococcus aureus (ATCC 29213), Acinetobacter baumannii (ATCC BAA-747), Enterococcus faecalis (ATCC 29212), and Pseudomonas aeruginosa (ATCC 27853) | 2013 | 24224794 |
| antitb_1844 | Hytramycin V | (METH-Ala)-(D-Pip)-L-(D-VAL)-Pip-(D-Pip) | Free | Free | METH-ALA= Methylated alanine, D-Pip = piperazic acid moieties | Cyclic (Intrachain bond between 1-6) | 6 | Mix | NA | Natural | From Streptomyces hygroscopicus strain ECUM 14046 | Mycobacterium tuberculosis | Mycobacterium tuberculosis resistant to moxifloxacin (rMOX) | MIC = 9.0 μg/mL | In vitro | None | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial (Escherichia coli (ATCC 25922), Staphylococcus aureus (ATCC 29213), Acinetobacter baumannii (ATCC BAA-747), Enterococcus faecalis (ATCC 29212), and Pseudomonas aeruginosa (ATCC 27853) | 2013 | 24224794 |
| antitb_1845 | Hytramycin V | (METH-Ala)-(D-Pip)-L-(D-VAL)-Pip-(D-Pip) | Free | Free | METH-ALA= Methylated alanine, D-Pip = piperazic acid moieties | Cyclic (Intrachain bond between 1-6) | 6 | Mix | NA | Natural | From Streptomyces hygroscopicus strain ECUM 14046 | Mycobacterium tuberculosis | Mycobacterium tuberculosis resistant to capreomycin (rCAP) | MIC = 12.1 μg/mL | In vitro | None | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial (Escherichia coli (ATCC 25922), Staphylococcus aureus (ATCC 29213), Acinetobacter baumannii (ATCC BAA-747), Enterococcus faecalis (ATCC 29212), and Pseudomonas aeruginosa (ATCC 27853) | 2013 | 24224794 |
| antitb_1846 | Hytramycin I | (METH-Ala)-(D-Pip)-L-( D-Allo-ILE)-Pip-(D-Pip) | Free | Free | METH-ALA= Methylated alanine, D-Pip = piperazic acid moieties, D-Allo-ILE= D form of Allo-isoleucine | Cyclic (Intrachain bond between 1-6) | 6 | Mix | NA | Natural | From Streptomyces hygroscopicus strain ECUM 14046 | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 6.0 μg/mL | In vitro | None | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial (Escherichia coli (ATCC 25922), Staphylococcus aureus (ATCC 29213), Acinetobacter baumannii (ATCC BAA-747), Enterococcus faecalis (ATCC 29212), and Pseudomonas aeruginosa (ATCC 27853) | 2013 | 24224794 |
| antitb_1847 | Hytramycin I | (METH-Ala)-(D-Pip)-L-( D-Allo-ILE)-Pip-(D-Pip) | Free | Free | METH-ALA= Methylated alanine, D-Pip = piperazic acid moieties, D-Allo-ILE= D form of Allo-isoleucine | Cyclic (Intrachain bond between 1-6) | 6 | Mix | NA | Natural | From Streptomyces hygroscopicus strain ECUM 14046 | Mycobacterium tuberculosis | Clinical isolate, X004439 | MIC = 4.4 μg/mL | In vitro | None | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial (Escherichia coli (ATCC 25922), Staphylococcus aureus (ATCC 29213), Acinetobacter baumannii (ATCC BAA-747), Enterococcus faecalis (ATCC 29212), and Pseudomonas aeruginosa (ATCC 27853) | 2013 | 24224794 |
| antitb_1848 | Hytramycin I | (METH-Ala)-(D-Pip)-L-( D-Allo-ILE)-Pip-(D-Pip) | Free | Free | METH-ALA= Methylated alanine, D-Pip = piperazic acid moieties, D-Allo-ILE= D form of Allo-isoleucine | Cyclic (Intrachain bond between 1-6) | 6 | Mix | NA | Natural | From Streptomyces hygroscopicus strain ECUM 14046 | Mycobacterium tuberculosis | Clinical isolate, X004244 | MIC = 4.7 μg/mL | In vitro | None | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial (Escherichia coli (ATCC 25922), Staphylococcus aureus (ATCC 29213), Acinetobacter baumannii (ATCC BAA-747), Enterococcus faecalis (ATCC 29212), and Pseudomonas aeruginosa (ATCC 27853) | 2013 | 24224794 |
| antitb_1849 | Hytramycin I | (METH-Ala)-(D-Pip)-L-( D-Allo-ILE)-Pip-(D-Pip) | Free | Free | METH-ALA= Methylated alanine, D-Pip = piperazic acid moieties, D-Allo-ILE= D form of Allo-isoleucine | Cyclic (Intrachain bond between 1-6) | 6 | Mix | NA | Natural | From Streptomyces hygroscopicus strain ECUM 14046 | Mycobacterium tuberculosis | Clinical isolate, X005282 | MIC = 4.7 μg/mL | In vitro | None | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial (Escherichia coli (ATCC 25922), Staphylococcus aureus (ATCC 29213), Acinetobacter baumannii (ATCC BAA-747), Enterococcus faecalis (ATCC 29212), and Pseudomonas aeruginosa (ATCC 27853) | 2013 | 24224794 |
| antitb_1850 | Hytramycin I | (METH-Ala)-(D-Pip)-L-( D-Allo-ILE)-Pip-(D-Pip) | Free | Free | METH-ALA= Methylated alanine, D-Pip = piperazic acid moieties, D-Allo-ILE= D form of Allo-isoleucine | Cyclic (Intrachain bond between 1-6) | 6 | Mix | NA | Natural | From Streptomyces hygroscopicus strain ECUM 14046 | Mycobacterium tuberculosis | Clinical isolate, X005319 | MIC = 4.8 μg/mL | In vitro | None | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial (Escherichia coli (ATCC 25922), Staphylococcus aureus (ATCC 29213), Acinetobacter baumannii (ATCC BAA-747), Enterococcus faecalis (ATCC 29212), and Pseudomonas aeruginosa (ATCC 27853) | 2013 | 24224794 |
| antitb_1851 | Hytramycin I | (METH-Ala)-(D-Pip)-L-( D-Allo-ILE)-Pip-(D-Pip) | Free | Free | METH-ALA= Methylated alanine, D-Pip = piperazic acid moieties, D-Allo-ILE= D form of Allo-isoleucine | Cyclic (Intrachain bond between 1-6) | 6 | Mix | NA | Natural | From Streptomyces hygroscopicus strain ECUM 14046 | Mycobacterium tuberculosis | Clinical isolate, X001354 | MIC = 4.7 μg/mL | In vitro | None | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial (Escherichia coli (ATCC 25922), Staphylococcus aureus (ATCC 29213), Acinetobacter baumannii (ATCC BAA-747), Enterococcus faecalis (ATCC 29212), and Pseudomonas aeruginosa (ATCC 27853) | 2013 | 24224794 |
| antitb_1852 | Hytramycin I | (METH-Ala)-(D-Pip)-L-( D-Allo-ILE)-Pip-(D-Pip) | Free | Free | METH-ALA= Methylated alanine, D-Pip = piperazic acid moieties, D-Allo-ILE= D form of Allo-isoleucine | Cyclic (Intrachain bond between 1-6) | 6 | Mix | NA | Natural | From Streptomyces hygroscopicus strain ECUM 14046 | Mycobacterium tuberculosis | Clinical isolate, X003899 | MIC = 4.8 μg/mL | In vitro | None | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial (Escherichia coli (ATCC 25922), Staphylococcus aureus (ATCC 29213), Acinetobacter baumannii (ATCC BAA-747), Enterococcus faecalis (ATCC 29212), and Pseudomonas aeruginosa (ATCC 27853) | 2013 | 24224794 |
| antitb_1853 | Hytramycin I | (METH-Ala)-(D-Pip)-L-( D-Allo-ILE)-Pip-(D-Pip) | Free | Free | METH-ALA= Methylated alanine, D-Pip = piperazic acid moieties, D-Allo-ILE= D form of Allo-isoleucine | Cyclic (Intrachain bond between 1-6) | 6 | Mix | NA | Natural | From Streptomyces hygroscopicus strain ECUM 14046 | Mycobacterium tuberculosis | Mycobacterium tuberculosis resistant to streptomycin (rSM, ATCC 35820) | MIC = 4.7 μg/mL | In vitro | None | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial (Escherichia coli (ATCC 25922), Staphylococcus aureus (ATCC 29213), Acinetobacter baumannii (ATCC BAA-747), Enterococcus faecalis (ATCC 29212), and Pseudomonas aeruginosa (ATCC 27853) | 2013 | 24224794 |
| antitb_1854 | Hytramycin I | (METH-Ala)-(D-Pip)-L-( D-Allo-ILE)-Pip-(D-Pip) | Free | Free | METH-ALA= Methylated alanine, D-Pip = piperazic acid moieties, D-Allo-ILE= D form of Allo-isoleucine | Cyclic (Intrachain bond between 1-6) | 6 | Mix | NA | Natural | From Streptomyces hygroscopicus strain ECUM 14046 | Mycobacterium tuberculosis | Mycobacterium tuberculosis resistant to rifampin (rRMP, ATCC 35838) | MIC = 4.7 μg/mL | In vitro | None | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial (Escherichia coli (ATCC 25922), Staphylococcus aureus (ATCC 29213), Acinetobacter baumannii (ATCC BAA-747), Enterococcus faecalis (ATCC 29212), and Pseudomonas aeruginosa (ATCC 27853) | 2013 | 24224794 |
| antitb_1855 | Hytramycin I | (METH-Ala)-(D-Pip)-L-( D-Allo-ILE)-Pip-(D-Pip) | Free | Free | METH-ALA= Methylated alanine, D-Pip = piperazic acid moieties, D-Allo-ILE= D form of Allo-isoleucine | Cyclic (Intrachain bond between 1-6) | 6 | Mix | NA | Natural | From Streptomyces hygroscopicus strain ECUM 14046 | Mycobacterium tuberculosis | Mycobacterium tuberculosis resistant to kanamycin (rKM, ATCC 35827) | MIC = 4.9 μg/mL | In vitro | None | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial (Escherichia coli (ATCC 25922), Staphylococcus aureus (ATCC 29213), Acinetobacter baumannii (ATCC BAA-747), Enterococcus faecalis (ATCC 29212), and Pseudomonas aeruginosa (ATCC 27853) | 2013 | 24224794 |
| antitb_1856 | Hytramycin I | (METH-Ala)-(D-Pip)-L-( D-Allo-ILE)-Pip-(D-Pip) | Free | Free | METH-ALA= Methylated alanine, D-Pip = piperazic acid moieties, D-Allo-ILE= D form of Allo-isoleucine | Cyclic (Intrachain bond between 1-6) | 6 | Mix | NA | Natural | From Streptomyces hygroscopicus strain ECUM 14046 | Mycobacterium tuberculosis | Mycobacterium tuberculosis resistant to isoniazid (rINH, ATCC 35822) | MIC = 4.7 μg/mL | In vitro | None | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial (Escherichia coli (ATCC 25922), Staphylococcus aureus (ATCC 29213), Acinetobacter baumannii (ATCC BAA-747), Enterococcus faecalis (ATCC 29212), and Pseudomonas aeruginosa (ATCC 27853) | 2013 | 24224794 |
| antitb_1857 | Hytramycin I | (METH-Ala)-(D-Pip)-L-( D-Allo-ILE)-Pip-(D-Pip) | Free | Free | METH-ALA= Methylated alanine, D-Pip = piperazic acid moieties, D-Allo-ILE= D form of Allo-isoleucine | Cyclic (Intrachain bond between 1-6) | 6 | Mix | NA | Natural | From Streptomyces hygroscopicus strain ECUM 14046 | Mycobacterium tuberculosis | Mycobacterium tuberculosis resistant to cycloserine (rCS, ATCC 35826) | MIC = 7.4 μg/mL | In vitro | None | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial (Escherichia coli (ATCC 25922), Staphylococcus aureus (ATCC 29213), Acinetobacter baumannii (ATCC BAA-747), Enterococcus faecalis (ATCC 29212), and Pseudomonas aeruginosa (ATCC 27853) | 2013 | 24224794 |
| antitb_1858 | Hytramycin I | (METH-Ala)-(D-Pip)-L-( D-Allo-ILE)-Pip-(D-Pip) | Free | Free | METH-ALA= Methylated alanine, D-Pip = piperazic acid moieties, D-Allo-ILE= D form of Allo-isoleucine | Cyclic (Intrachain bond between 1-6) | 6 | Mix | NA | Natural | From Streptomyces hygroscopicus strain ECUM 14046 | Mycobacterium tuberculosis | Mycobacterium tuberculosis resistant to moxifloxacin (rMOX) | MIC = 4.0 μg/mL | In vitro | None | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial (Escherichia coli (ATCC 25922), Staphylococcus aureus (ATCC 29213), Acinetobacter baumannii (ATCC BAA-747), Enterococcus faecalis (ATCC 29212), and Pseudomonas aeruginosa (ATCC 27853) | 2013 | 24224794 |
| antitb_1859 | Hytramycin I | (METH-Ala)-(D-Pip)-L-( D-Allo-ILE)-Pip-(D-Pip) | Free | Free | METH-ALA= Methylated alanine, D-Pip = piperazic acid moieties, D-Allo-ILE= D form of Allo-isoleucine | Cyclic (Intrachain bond between 1-6) | 6 | Mix | NA | Natural | From Streptomyces hygroscopicus strain ECUM 14046 | Mycobacterium tuberculosis | Mycobacterium tuberculosis resistant to capreomycin (rCAP) | MIC = 4.8 μg/mL | In vitro | None | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial (Escherichia coli (ATCC 25922), Staphylococcus aureus (ATCC 29213), Acinetobacter baumannii (ATCC BAA-747), Enterococcus faecalis (ATCC 29212), and Pseudomonas aeruginosa (ATCC 27853) | 2013 | 24224794 |
| antitb_1860 | Anoplin | GLLKRIKTLL | Free | Amidation | None | Linear | 10 | L | Cationic | Natural | Derived from the venom sac of the solitary wasp, Anoplius samariensis | Mycobacterium smegmatis | Mycobacterium smegmatis mc2 155 | MIC = 200 μg/mL | In vitro | RBC | NA | Non toxic to erythrocytes | NA | NA | NA | NA | NA | NA | Antifungal (C. parapsilosis) and Antibacterial (Escherichia coli DH5a, Pseudomonas aeruginosa PAO, and Zymomonas mobilis ATCC 10988; Gram-positive bacteria: Bacillus subtilis DELTA) | 2016 | 27862650 |
| antitb_1869 | Mastoparan Polybia-MPII | INWLKLGKMVIDAL | Free | Free | None | Linear | 14 | L | Cationic | Natural | Isolated from venom of the social wasp Pseudopolybia vespiceps testacea | Mycobacterium abscessus | Mycobacterium abscessus subsp. massiliense GO06 | 80% inhibition at 12.5 μM | In vitro | murine macrophages, human and mouse erythrocytes | 80% inhibition at 12.5 μM | 50% hemolysis at 24.18 μM and 48.47 μM against mouse and human erythrocytes respectively | NA | NA | NA | membrane pore formation | cell membrane | NA | Antifungal (Candida albicans and Cryptococcus neoformans) and Antibacterial (Staphylococcus aureus) | 2017 | 28108242 |
| antitb_1873 | Magainin | GIGKFLHSAKKFGKAFVGEIMNS | Free | Free | None | Linear | 23 | L | Cationic | Natural | Peptide from Xenopus laevis skin | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv (ATCC 27294) | MIC >300 μM | In vitro | RBC | NA | 50% hemolysis at >300 μM | NA | NA | NA | NA | NA | NA | Antibacterial (Streptococcus pneumoniae) | 2017 | 28314993 |
| antitb_1874 | Buforin II (5–21) | RAGLQFPVGRVHRLLRK | Free | Free | None | Linear | 17 | L | Cationic | Natural | Peptide from the stomach tissue of Bufo bufo garagrizans | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv (ATCC 27294) | MIC >300 μM | In vitro | RBC | NA | 50% hemolysis at >300 μM | NA | NA | NA | NA | NA | NA | Antibacterial (Streptococcus pneumoniae) | 2017 | 28314993 |
| antitb_1877 | Crot(1–9,38–42) | YKQCHKKGGKKGSG | Free | Free | None | Linear | 14 | L | Cationic | Natural | Crotamine, a toxin of Crotalus durissus terrificus | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv (ATCC 27294) | MIC >300 μM | In vitro | RBC | NA | 50% hemolysis at >300 μM | NA | NA | NA | NA | NA | NA | Antibacterial (Streptococcus pneumoniae) | 2017 | 28314993 |
| antitb_1879 | Melittin | GIGAVLKVLTTGLPALISWIKRKRQQ | Free | Free | None | Linear | 26 | L | Cationic | Natural | Venom of Apis mellifera | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv (ATCC 27294) | MIC >300 μM | In vitro | RBC | NA | 50% hemolysis at 0.339 ± 0.0854 μM | NA | NA | NA | NA | NA | NA | Antibacterial (Streptococcus pneumoniae) | 2017 | 28314993 |
| antitb_1881 | Polydim-I | AVAGEKLWLLPHLLKMLLTPTP | Free | Free | None | Linear | 22 | L | Amphipathic | Natural | Isolated from the venom of the Neotropical wasp Polybia dimorpha | Mycobacterium abscessus | Mycobacterium abscessus subsp. massiliense isolates GO 01, GO 06, GO 07, GO 08, GO 13, and GO 18, CRM0020 (Mycobacterium abscessus subsp. massiliense), and ATCC19977 (Mycobacterium abscessus subsp. abscessus) | MIC = 60.8 μg/mL | Both | Peritoneal macrophages, J774 macrophages cells, human red blood cells | Treatment of infected macrophages with 7.6 μg/mL of Polydim-I decreased approximately 50% of the bacterial load | Non-cytotoxic, 10% cytotoxicity on J774 cells at concentrations above 121.6 μg/mL (10%) and concentrations up to 121.6 μg/mL presented less than 2.5% of hemolytic activity | 6 to 8 weeks old BALB/c and IFN-γKO (Knockout) female mice | 2 mg/kg/mLW shows 90% reduction in bacterial load | NA | Cell wall disruption | Cell wall | None | NA | 2016 | 26930596 |
| antitb_1882 | Propeptin-2 | GYPWWDYRDLFGGHTFI | Involved in Cyclic bond formation between amino acid 1 and 9 | Free | None | Cyclic | 17 | D | NA | Natural | Isolated from Microbispora species SNA-115 | Mycobacterium phlei | Mycobacterium phlei IFO 3158 | 40 μg/disc | In vitro | NA | Treatment of infected Mycobacterium phlei with 40 μg/disc of Propeptin-2 decreased approximately 90% of the bacterial load in zone inhibition assay | NA | NA | NA | NA | NA | NA | None | Antibacterial against silkworm | 2007 | 17827663 |
| antitb_1883 | Propeptin | GYPWWDYRDLFGGHTFISP | Involved in Cyclic bond formation between amino acid 1 and 9 | Free | None | Cyclic | 19 | D | NA | Natural | Isolated from Microbispora species SNA-115 | Mycobacterium smegmatis | Mycobacterium smegmatis M341 | MIC90 = 100 μg/mL | In vivo | NA | Treatment of infected Mycobacterium smegmatis with 100 μg/ml of Propeptin decreased approximately 90% of the bacterial load | NA | Silkworm hemolymph infected with mycobacterium smegmatis at (1.25 × 107 CFU) | 1.25 × 107 CFU | NA | NA | NA | None | None | 2017 | 28446822 |
| antitb_1884 | Trichoderins A | PXXXIVXX | Addition of MDA (2-methyl decanoic acid) | Addition of AMAE (2-[(20-aminopropyl) methylamino] ethanol) | Addition of AHMOD at residue 2 (2-amino-6-hydroxy-4-methyl-8-oxodecanoic acid) and AIB (a-aminoisobutyric acid) at 3,4,7, and 8 | Cyclic | 8 | D | NA | Natural | Isolated from Trichoderma species 05FI48 | Mycobacterium smegmatis | Mycobacterium smegmatis | MIC = 0.1 μg/mL | In vitro | NA | Tratment with this concentration inhibit 100% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2010 | 20483615 |
| antitb_1885 | Trichoderins A | PXXXIVXX | Addition of MDA (2-methyl decanoic acid) | Addition of AMAE (2-[(20-aminopropyl) methylamino] ethanol) | Addition of AHMOD at residue 2 (2-amino-6-hydroxy-4-methyl-8-oxodecanoic acid) and AIB (a-aminoisobutyric acid) at 3,4,7, and 8 | Cyclic | 8 | D | NA | Natural | Isolated from Trichoderma species 05FI48 | Mycobacterium bovis | Mycobacterium bovis BCG | MIC = 0.02 μg/ml | In vitro | NA | Tratment with this concentration inhibit 100% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2010 | 20483615 |
| antitb_1886 | Trichoderins A | PXXXIVXX | Addition of MDA (2-methyl decanoic acid) | Addition of AMAE (2-[(20-aminopropyl) methylamino] ethanol) | Addition of AHMOD at residue 2 (2-amino-6-hydroxy-4-methyl-8-oxodecanoic acid) and AIB (a-aminoisobutyric acid) at 3,4,7, and 8 | Cyclic | 8 | D | NA | Natural | Isolated from Trichoderma species 05FI48 | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37RV | MIC = 0.12 μg/ml | In vitro | NA | Tratment with this concentration inhibit 100% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2010 | 20483615 |
| antitb_1887 | Trichoderins A1 | PXXXIVXX | Addition of MDA (2-methyl decanoic acid) | Addition of AMAE (2-[(20-aminopropyl) methylamino] ethanol) | Addition of AHMOD at residue 2 (2-amino-6-hydroxy-4-methyl-8-oxodecanoic acid) and AIB (a-aminoisobutyric acid) at 3,4,7, and 8 | Cyclic | 8 | D | NA | Natural | Isolated from Trichoderma species 05FI48 | Mycobacterium smegmatis | Mycobacterium smegmatis M341 | MIC = 1.56 μg/mL | In vitro | NA | Tratment with this concentration inhibit 100% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2010 | 20483615 |
| antitb_1888 | Trichoderins A | PXXXIVXX | Addition of MDA (2-methyl decanoic acid) | Addition of AMAE (2-[(20-aminopropyl) methylamino] ethanol) | Addition of AHMOD at residue 2 (2-amino-6-hydroxy-4-methyl-8-oxodecanoic acid) and AIB (a-aminoisobutyric acid) at 3,4,7, and 8 | Cyclic | 8 | D | NA | Natural | Isolated from Trichoderma species 05FI48 | Mycobacterium bovis | Mycobacterium bovis BCG | MIC = 0.16 μg/ml | In vitro | NA | Tratment with this concentration inhibit 100% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2010 | 20483615 |
| antitb_1889 | Trichoderins A1 | PXXXIVXX | Addition of MDA (2-methyl decanoic acid) | Addition of AMAE (2-[(20-aminopropyl) methylamino] ethanol) | Addition of AHMOD at residue 2 (2-amino-6-hydroxy-4-methyl-8-oxodecanoic acid) and AIB (a-aminoisobutyric acid) at 3,4,7, and 8 | Cyclic | 8 | D | NA | Natural | Isolated from Trichoderma species 05FI48 | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37RV | MIC = 2.0 μg/ml | In vitro | NA | Tratment with this concentration inhibit 100% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2010 | 20483615 |
| antitb_1890 | Trichoderin B | PXXXVVXX | Addition of MDA (2-methyl decanoic acid) | Addition of AMAE (2-[(20-aminopropyl) methylamino] ethanol) | Addition of AHMOD at residue 2 (2-amino-6-hydroxy-4-methyl-8-oxodecanoic acid) and AIB (a-aminoisobutyric acid) at 3,4,7, and 8 | Cyclic | 8 | D | NA | Natural | Isolated from Trichoderma species 05FI48 | Mycobacterium smegmatis | Mycobacterium smegmatis M341 | MIC = 0.63 μg/mL | In vitro | NA | Tratment with this concentration inhibit 100% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2010 | 20483615 |
| antitb_1891 | Trichoderin B | PXXXVVXX | Addition of MDA (2-methyl decanoic acid) | Addition of AMAE (2-[(20-aminopropyl) methylamino] ethanol) | Addition of AHMOD at residue 2 (2-amino-6-hydroxy-4-methyl-8-oxodecanoic acid) and AIB (a-aminoisobutyric acid) at 3,4,7, and 8 | Cyclic | 8 | D | NA | Natural | Isolated from Trichoderma species 05FI48 | Mycobacterium bovis | Mycobacterium bovis BCG | MIC = 0.02 μg/ml | In vitro | NA | Tratment with this concentration inhibit 100% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2010 | 20483615 |