Primary information |
---|
ID | antitb_1812 |
Peptide Name | mouse CRAMP |
Sequence | GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ |
N-terminal Modification | Free |
C-terminal Modification | Free |
Chemical Modification | None |
Linear/ Cyclic | Linear |
Length | 34 |
Chirality | L |
Nature | Cationic |
Source | Natural |
Origin | Mouse cells |
Species | Mycobacterium tuberculosis |
Strain | Mycobacterium tuberculosis strain H37Rv |
Inhibition Concentartion | MIC = 4 μM |
In vitro/In vivo | Both |
Cell Line | NA |
Inhibition Concentartion | NA |
Cytotoxicity | NA |
In vivo Model | Male BALB/c mice |
Lethal Dose | a significant reduction in bacilli loads |
Immune Response | NA |
Mechanism of Action | Disruption of cell wall and membrane |
Target | cell wall and membrane |
Combination Therapy | NA |
Other Activities | Antibacterial (P.aeruginosa) |
Pubmed ID | 23141114 |
Year of Publication | 2012 |
3-D Structure | NA |