| Primary information |
|---|
| ID | antitb_1777, |
| Name | 16687191 |
| N-Terminal modification | Mitogenic defensin |
| C-Terminal Modification | MEKKSFAGLCFLFLVLFVAQECVLQTEAKTCENLADTFRGPCFATGNCDDHCKNKEHLLRGRCRDDFRCWCTRNC |
| Chemical Modification | Free |
| Linear/Cyclic | Free |
| Length | Disulfide linkage |
| Chirality | Cyclic |
| Nature | 75 |
| Source | L |
| Origin | Cationic |
| Species | Natural |
| Strain | From the seeds of white cloud beans (Phaseolus vulgaris cv. ‘white cloud bean’) |
| Inhibition Concentration | Mycobacterium phlei |
| In Vitro/ In vivo | Mycobacterium phlei |
| Cell Line | IC50 = 86 ± 6 µM |
| Inhibition Concentration | In vitro |
| Sequence | 2006 |
| Cytotoxicity | NA |
| In vivo Model | NA |
| Lethal Dose | NA |
| Immune Responce | NA |
| Mechanism of Action | NA |
| Target | NA |
| Combination Therapy | NA |
| Other activities | NA |
| PMID | NA |
| Year of Publication | Antibacterial, Antifungal |
Tertiary Structure
(Technique) | Not Predicted), |