Primary information |
---|
ID | antitb_1777 |
Peptide Name | Mitogenic defensin |
Sequence | MEKKSFAGLCFLFLVLFVAQECVLQTEAKTCENLADTFRGPCFATGNCDDHCKNKEHLLRGRCRDDFRCWCTRNC |
N-terminal Modification | Free |
C-terminal Modification | Free |
Chemical Modification | Disulfide linkage |
Linear/ Cyclic | Cyclic |
Length | 75 |
Chirality | L |
Nature | Cationic |
Source | Natural |
Origin | From the seeds of white cloud beans (Phaseolus vulgaris cv. ‘white cloud bean’) |
Species | Mycobacterium phlei |
Strain | Mycobacterium phlei |
Inhibition Concentartion | IC50 = 86 ± 6 µM |
In vitro/In vivo | In vitro |
Cell Line | NA |
Inhibition Concentartion | NA |
Cytotoxicity | NA |
In vivo Model | NA |
Lethal Dose | NA |
Immune Response | NA |
Mechanism of Action | NA |
Target | NA |
Combination Therapy | NA |
Other Activities | Antibacterial, Antifungal |
Pubmed ID | 16687191 |
Year of Publication | 2006 |
3-D Structure | NA |