| Primary information |
|---|
| ID | antitb_1812, |
| Name | 23141114 |
| N-Terminal modification | mouse CRAMP |
| C-Terminal Modification | GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ |
| Chemical Modification | Free |
| Linear/Cyclic | Free |
| Length | None |
| Chirality | Linear |
| Nature | 34 |
| Source | L |
| Origin | Cationic |
| Species | Natural |
| Strain | Mouse cells |
| Inhibition Concentration | Mycobacterium tuberculosis |
| In Vitro/ In vivo | Mycobacterium tuberculosis strain H37Rv |
| Cell Line | MIC = 4 μM |
| Inhibition Concentration | Both |
| Sequence | 2012 |
| Cytotoxicity | NA |
| In vivo Model | NA |
| Lethal Dose | NA |
| Immune Responce | Male BALB/c mice |
| Mechanism of Action | a significant reduction in bacilli loads |
| Target | NA |
| Combination Therapy | Disruption of cell wall and membrane |
| Other activities | cell wall and membrane |
| PMID | NA |
| Year of Publication | Antibacterial (P.aeruginosa) |
Tertiary Structure
(Technique) | Not Predicted), |