| Primary information |
|---|
| ID | antitb_1811 |
| Peptide Name | LL- 37 |
| Sequence | [LL-37, 37 aa] |
| N-terminal Modification | Free |
| C-terminal Modification | Free |
| Chemical Modification | None |
| Linear/ Cyclic | Linear |
| Length | 37 |
| Chirality | L |
| Nature | Cationic |
| Source | Natural |
| Origin | Human cells |
| Species | Mycobacterium tuberculosis |
| Strain | Mycobacterium tuberculosis strain H37Rv |
| Inhibition Concentartion | MIC = 5 μM |
| In vitro/In vivo | Both |
| Cell Line | NA |
| Inhibition Concentartion | NA |
| Cytotoxicity | NA |
| In vivo Model | Male BALB/c mice |
| Lethal Dose | a significant reduction in bacilli loads |
| Immune Response | NA |
| Mechanism of Action | Disruption of cell wall and membrane |
| Target | cell wall and membrane |
| Combination Therapy | NA |
| Other Activities | Antibacterial (P.aeruginosa) |
| Pubmed ID | 23141114 |
| Year of Publication | 2012 |
| 3-D Structure | NA |