Browse result page of AntiTbPdb
The total number entries retrieved from this search are 106
| ID | Name | Sequence | N-Terminal Modification | C-Terminal Modification | Chemical Modification | Linear/Cyclic | Length | Chirality | Nature | Source | Origin | Species | Strain | Inhibition Concentration | In vitro/ In vivo | Cell Line | Intracellular Inhibition | Cytotoxicity | Animal Model | Effective Dose in model organism | Immune Responce | Mechanism of Action | Target | Combination Therapy | Other Activities | Year of Publication | Pubmed ID/ Patent No. |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| antitb_1434 | Tuberactinomycin O | H2N-CH-CH-CH-CH-R1-CH-NH2-Ch-CO-Nh-C-CO-NH-CH2OH-CO-NH-CH(CH2OH)-CO-NH-R2-CO-R3-HN-CH | Free | Free | R1 = H, R2 = >C=CHNHCONH2, R3 =Cpd (Capreomycidine) | NA | 38 | NA | NA | NA | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis 607 | MIC = 1.6 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial against Bacillus subtilis, Pseudomonas aeruginosa, proteus vulgaris, satphylococus aureous | 1977 | 197067 |
| antitb_1435 | Dihydroviomycin | H2N-CH-CH-CH-CH-R1-CH-NH2-Ch-CO-Nh-C-CO-NH-CH2OH-CO-NH-CH(CH2OH)-CO-NH-R2-CO-R3-HN-CH | Free | Free | None | NA | 38 | NA | NA | NA | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis 607 | MIC = 6.2 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial against Bacillus subtilis, Pseudomonas aeruginosa, proteus vulgaris, satphylococus aureous | 1977 | 197067 |
| antitb_1436 | Tetrahydroviomycin | H2N-CH-CH-CH-CH-R1-CH-NH2-Ch-CO-Nh-C-CO-NH-CH2OH-CO-NH-CH(CH2OH)-CO-NH-R2-CO-R3-HN-CH | Free | Free | R1 = H, r2 = >CH-OH, R3=Tbd(Tuberactidine) | NA | 38 | NA | NA | NA | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis 607 | MIC = 3.1 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial against Bacillus subtilis, Pseudomonas aeruginosa, proteus vulgaris, satphylococus aureous | 1977 | 197067 |
| antitb_1437 | Oxoviomycin | H2N-CH-CH-CH-CH-R1-CH-NH2-Ch-CO-Nh-C-CO-NH-CH2OH-CO-NH-CH(CH2OH)-CO-NH-R2-CO-R3-HN-CH | Free | Free | R1= H, R2 = > c=o, R3 = Tbd (Tuberactidine) | NA | 38 | NA | NA | NA | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis 607 | NA | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial against Bacillus subtilis, Pseudomonas aeruginosa, proteus vulgaris, satphylococus aureous | 1977 | 197067 |
| antitb_1438 | Broxoviomycin | H2N-CH-CH-CH-CH-R1-CH-NH2-Ch-CO-Nh-C-CO-NH-CH2OH-CO-NH-CH(CH2OH)-CO-NH-R2-CO-R3-HN-CH | Free | Free | R1 = H, r2 = >CH-OH, R3=Tbd(Tuberactidine) | NA | 38 | NA | NA | NA | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis 607 | MIC = 800 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial against Bacillus subtilis, Pseudomonas aeruginosa, proteus vulgaris, satphylococus aureous | 1977 | 197067 |
| antitb_1516 | PR-39 | RRRPRPPYLPRPRPPPFFPPRLPPRIPPGFPPRFPPRFP | Free | Free | None | Linear | 39 | L | Cationic | Natural | Derived from pig porcine | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | Reduction in growth is inhibited to to 30 % at conc. 6.25 mg/L | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial against E.coli, S.aureus, bacillus, pseudomonas | 2015 | 25681127 |
| antitb_1517 | PR-39 | RRRPRPPYLPRPRPPPFFPPRLPPRIPPGFPPRFPPRFP | Free | Free | None | Linear | 39 | L | Cationic | Natural | Derived from pig porcine | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | Reduction in growth is inhibited to to80% at conc. 50 mg/L | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial against E.coli, S.aureus, bacillus, pseudomonas | 2015 | 25681127 |
| antitb_1518 | PR-39 | RRRPRPPYLPRPRPPPFFPPRLPPRIPPGFPPRFPPRFP | Free | Free | None | Linear | 39 | L | Cationic | Natural | Derived from pig porcine | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | IC50 = 17± 9 mg/L | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial against E.coli, S.aureus, bacillus, pseudomonas | 2015 | 25681127 |
| antitb_1519 | PR-39 | RRRPRPPYLPRPRPPPFFPPRLPPRIPPGFPPRFPPRFP | Free | Free | None | Linear | 39 | L | Cationic | Natural | Derived from pig porcine | Mycobacterium tuberculosis | Mycobacterium tuberculosis E1380/94 (MDR resistant stain) | IC50= 93± 12 mg/L | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial against E.coli, S.aureus, bacillus, pseudomonas | 2015 | 25681127 |
| antitb_1520 | PR-39 | RRRPRPPYLPRPRPPPFFPPRLPPRIPPGFPPRFPPRFP | Free | Free | None | Linear | 39 | L | Cationic | Natural | Derived from pig porcine | Mycobacterium smegmatis | Mycobacterium smegmatis susceptible strain | 50 mg/L | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial against E.coli, S.aureus, bacillus, pseudomonas | 2015 | 25681127 | |
| antitb_1521 | PR-39 | RRRPRPPYLPRPRPPPFFPPRLPPRIPPGFPPRFPPRFP | Free | Free | None | Linear | 39 | L | Cationic | Natural | Derived from pig porcine | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | IC50= 50 mg/L | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial against E.coli, S.aureus, bacillus, pseudomonas | 2015 | 25681127 | |
| antitb_1522 | PR-39 | RRRPRPPYLPRPRPPPFFPPRLPPRIPPGFPPRFPPRFP | Free | Free | None | Linear | 39 | L | Cationic | Natural | Derived from pig porcine | Mycobacterium tuberculosis | Mycobacterium tuberculosis E1380/94 (MDR resistant stain) | IC50= 50 mg/L | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial against E.coli, S.aureus, bacillus, pseudomonas | 2015 | 25681127 | |
| antitb_1523 | PR-39 | RRRPRPPYLPRPRPPPFFPPRLPPRIPPGFPPRFPPRFP | Free | Free | None | Linear | 39 | L | Cationic | Natural | Derived from pig porcine | Mycobacterium avium | Mycobacterium avium susceptible strain | MIC= 50 mg/L | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial against E.coli, S.aureus, bacillus, pseudomonas | 2015 | 25681127 | |
| antitb_1524 | NK-Lysin | NEDTVTQAASRVCDKMKILRGVCKKIMRTFLRRISKD | Free | Free | None | Linear | 36 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | Reduction in bacterial growth inhibiton to 60% at conc. Of 9.37 mg/L | in vitro | NA | NA | NA | NA | NA | NA | Inteacting with microbial membrane | NA | NA | Antibacterial against E.coli, S.aureus, bacillus, pseudomonas | 2015 | 25681127 |
| antitb_1528 | LL-37 | [LL-37, 37 aa] | Free | Free | None | Linear | 37 | L | Cationic | Protein derived | Derived from Human cationic antimicrobial protein 18 (hCAP18) | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 2.1 μg/ml | in vitro | Human macrophage THP1 | NA | No cytotoxicity | C57BL/6 Mice | NA | Induce expression of IL-8 and MCP-1 | In vitro binding of bacterilamembrane and induce pore formation while in vivo activate TLR and monocyte to kill bacteria | Bacterial cell membrane | NA | NA | 2015 | 25613372 |
| antitb_1534 | Proregion | SVFPQQTTGQLAELQPQDRAGARASWMPMFQRRRRR | Free | Free | None | Linear | 36 | L | Cationic | Protein derived | Derived from Hepcidin protein | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | NA | in vitro | NA | NA | NA | NA | NA | induce expression of IFN-γ | Cause structural damage to mycobacteria | NA | NA | NA | 2015 | 25613372 |
| antitb_1538 | HCL2 | ESTYQGHHTPPVQKGLRYGIILFITSEVFFFAGFF | Free | Free | None | Linear | 35 | L | Cationic | Protein derived | Derived from Cytochrome C oxidase subunit 3 | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | NA | in vitro | Human macrophage THP1 | NA | No cytotoxicity | NA | NA | NA | Disrupt interaction between ESAT-6 and CFP10 | bacterial ESAT-6 | NA | NA | 2015 | 25613372 |
| antitb_1549 | NisinA | I-(Dhb)-A-I-D-L-A-(Dha)-P-G-A-K-(Abu)-G-A-L-M-G-A-N-M-K-(Abu)-A-(Abu)-A-N-S-I-H-V-(Dha)-L | Free | Free | Dha= Didehydroalanine, Dhb= Didehydroaminobutyric acid, Abu= 2-aminobutyric acid | Linear | 33 | L | Cationic | NA | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 60 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2015 | 25613372 |
| antitb_1553 | E50-52 | TTKNYGNGVCNSVNWCQCGNVWASCNLATGCAAWLCKLA | Free | Free | None | Linear | 39 | L | Cationic | Natural | Derived from Enterococcus faecalis | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC= 0.1mg/L (within macrophage) | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2015 | 25613372 |
| antitb_1554 | E50-52 | TTKNYGNGVCNSVNWCQCGNVWASCNLATGCAAWLCKLA | Free | Free | None | Linear | 39 | L | Cationic | Natural | Derived from Enterococcus faecalis | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 1μg/ml | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2015 | 25613372 |
| antitb_1555 | Pk34 | PRVIETKVHGREVTGLARNVSEENVDRLAKRWIK | Free | Free | None | Linear | 34 | L | Cationic | Mycobacteriophage derived | Derived from mycobacteriophage | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | IC50= 50 μg/ml | in vitro | NA | NA | Macrophage like J774A.1 cell line | BALB/C mice | 20mg/Kg | Increase production of cytokine like IFN-γ,TNF-α,IL-12,MCp-1, IL-10, IL-6 | NA | NA | NA | Bactericidal against E.coli, pseudomonas, S.aureus, Bacillus subtilis | 2015 | 25613372 |
| antitb_1583 | β-Defensin-1(HBD-1) | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK | Free | Free | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. | Cyclic | 36 | L | Cationic | Natural | Derived from beta defensin 1 OF HUMAN | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | CFU/well 3.11 ± 0.10 at peptide concentration 4 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
| antitb_1584 | β-Defensin-1(HBD-1) | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK | Free | Free | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. | Cyclic | 36 | L | Cationic | Natural | Derived from beta defensin 1 OF HUMAN | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | CFU/well 3.15 ± 0.0.16 at peptide concentration 64 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
| antitb_1585 | β-Defensin-1(HBD-1) | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK | Free | Free | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. | Cyclic | 36 | L | Cationic | Natural | Derived from beta defensin 1 OF HUMAN | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | CFU/well 1.31 ± 0.10 at peptide concentration 4 μg/ml + INH 0.06 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | peptide +INH | NA | 2004 | 15245864 |
| antitb_1586 | β-Defensin-1(HBD-1) | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK | Free | Free | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. | Cyclic | 36 | L | Cationic | Natural | Derived from beta defensin 1 OF HUMAN | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | NA | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | peptide +INH | NA | 2004 | 15245864 |
| antitb_1587 | β-Defensin-1(HBD-1) | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK | Free | Free | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. | Cyclic | 36 | L | Cationic | Natural | Derived from beta defensin 1 OF HUMAN | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | CFU/well 3.15 ± 0.20 at peptide concentration 4 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
| antitb_1588 | β-Defensin-1(HBD-1) | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK | Free | Free | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. | Cyclic | 36 | L | Cationic | Natural | Derived from beta defensin 1 OF HUMAN | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | CFU/well 3.21 ± 0.42 at peptide concentration 8 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
| antitb_1589 | β-Defensin-1(HBD-1) | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK | Free | Free | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. | Cyclic | 36 | L | Cationic | Natural | Derived from beta defensin 1 OF HUMAN | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | CFU/well 3.02 ± 0.30 at peptide concentration 16 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
| antitb_1590 | β-Defensin-1(HBD-1) | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK | Free | Free | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. | Cyclic | 36 | L | Cationic | Natural | Derived from beta defensin 1 OF HUMAN | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | CFU/well 2.991± 0.23 at peptide concentration 32 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
| antitb_1591 | β-Defensin-1(HBD-1) | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK | Free | Free | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. | Cyclic | 36 | L | Cationic | Natural | Derived from beta defensin 1 OF HUMAN | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | CFU/well 2.90± 0.20 at peptide concentration 64 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
| antitb_1592 | β-Defensin-1(HBD-1) | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK | Free | Free | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. | Cyclic | 36 | L | Cationic | Natural | Derived from beta defensin 1 OF HUMAN | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | CFU/well 2.80 ± 0.15 at peptide concentration 128 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
| antitb_1593 | β-Defensin-1(HBD-1) | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK | Free | Free | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. | Cyclic | 36 | L | Cationic | Natural | Derived from beta defensin 1 OF HUMAN | Mycobacterium tuberculosis | Mycobacterium tuberculosis RM22 | CFU/well 2.91 ± 0.19 at peptide concentration 4 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
| antitb_1594 | β-Defensin-1(HBD-1) | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK | Free | Free | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. | Cyclic | 36 | L | Cationic | Natural | Derived from beta defensin 1 OF HUMAN | Mycobacterium tuberculosis | Mycobacterium tuberculosis RM22 | CFU/well 2.89 ± 0.19 at peptide concentration 4 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
| antitb_1595 | β-Defensin-1(HBD-1) | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK | Free | Free | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. | Cyclic | 36 | L | Cationic | Natural | Derived from beta defensin 1 OF HUMAN | Mycobacterium tuberculosis | Mycobacterium tuberculosis RM22 | CFU/well 2.70 ± 0.15 at peptide concentration 64 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
| antitb_1596 | β-Defensin-1(HBD-1) | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK | Free | Free | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. | Cyclic | 36 | L | Cationic | Natural | Derived from beta defensin 1 OF HUMAN | Mycobacterium tuberculosis | Mycobacterium tuberculosis RM22 | CFU/well 2.90 ± 0.09 at peptide concentration 4 μg/ml + INH 4 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
| antitb_1597 | β-Defensin-1(HBD-1) | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK | Free | Free | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. | Cyclic | 36 | L | Cationic | Natural | Derived from beta defensin 1 OF HUMAN | Mycobacterium tuberculosis | Mycobacterium tuberculosis RM22 | CFU/well 2.91 ± 0.19 at peptide concentration 64 μg/ml + INH 4 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
| antitb_1598 | β-Defensin-1(HBD-1) | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK | Free | Free | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. | Cyclic | 36 | L | Cationic | Natural | Derived from beta defensin 1 OF HUMAN | Mycobacterium tuberculosis | Mycobacterium tuberculosis RM22 | CFU/well 2.93 ± 0.07 at peptide concentration 8 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | INH+peptide | NA | 2004 | 15245864 |
| antitb_1599 | β-Defensin-1(HBD-1) | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK | Free | Free | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. | Cyclic | 36 | L | Cationic | Natural | Derived from beta defensin 1 OF HUMAN | Mycobacterium tuberculosis | Mycobacterium tuberculosis RM22 | CFU/well 2.78 ± 0.15 at peptide concentration 16 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | INH+peptide | NA | 2004 | 15245864 |
| antitb_1600 | β-Defensin-1(HBD-1) | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK | Free | Free | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. | Cyclic | 36 | L | Cationic | Natural | Derived from beta defensin 1 OF HUMAN | Mycobacterium tuberculosis | Mycobacterium tuberculosis RM22 | CFU/well 2.80 ± 0.14 at peptide concentration 32 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
| antitb_1601 | β-Defensin-1(HBD-1) | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK | Free | Free | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. | Cyclic | 36 | L | Cationic | Natural | Derived from beta defensin 1 OF HUMAN | Mycobacterium tuberculosis | Mycobacterium tuberculosis RM22 | CFU/well 2.66 ± 0.15 at peptide concentration 64 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
| antitb_1602 | β-Defensin-1(HBD-1) | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK | Free | Free | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. | Cyclic | 36 | L | Cationic | Natural | Derived from beta defensin 1 OF HUMAN | Mycobacterium tuberculosis | Mycobacterium tuberculosis RM22 | CFU/well 2.60 ± 0.17 at peptide concentration 128 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
| antitb_1605 | β-Defensin-1(HBD-1) | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK | Free | Free | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. | Cyclic | 36 | L | Cationic | Natural | Derived from beta defensin 1 OF HUMAN | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | NA | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | Peptide(64 ul) + INH(4 ul) | NA | 2004 | 15245864 |
| antitb_1606 | β-Defensin-1(HBD-1) | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK | Free | Free | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. | Cyclic | 36 | L | Cationic | Natural | Derived from beta defensin 1 OF HUMAN | Mycobacterium tuberculosis | Mycobacterium tuberculosis RM22 | CFU/well 0.90 ± 0.75 at peptide 64ul + 4 ul of INH | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | Peptide(64 ul) + INH(4 ul) | NA | 2004 | 15245864 |
| antitb_1628 | LL-37 | [LL-37, 37 aa] | Free | Free | None | Linear | 37 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacteria smegmatis mc2 155 | MIC = 2400 μg/ml | in vitro | J774 macrophage cell lines | NA | IC50= 11226 μg/ml | NA | NA | Stimulation of TNF-α production | inhibit bacterial Atpase activity | NA | NA | NA | 2015 | 26218806 |
| antitb_1811 | LL- 37 | [LL-37, 37 aa] | Free | Free | None | Linear | 37 | L | Cationic | Natural | Human cells | Mycobacterium tuberculosis | Mycobacterium tuberculosis strain H37Rv | MIC = 5 μM | Both | NA | NA | NA | Male BALB/c mice | a significant reduction in bacilli loads | NA | Disruption of cell wall and membrane | cell wall and membrane | NA | Antibacterial (P.aeruginosa) | 2012 | 23141114 |
| antitb_1812 | mouse CRAMP | GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ | Free | Free | None | Linear | 34 | L | Cationic | Natural | Mouse cells | Mycobacterium tuberculosis | Mycobacterium tuberculosis strain H37Rv | MIC = 4 μM | Both | NA | NA | NA | Male BALB/c mice | a significant reduction in bacilli loads | NA | Disruption of cell wall and membrane | cell wall and membrane | NA | Antibacterial (P.aeruginosa) | 2012 | 23141114 |
| antitb_1966 | HIDFS1 | GFGCPFNARRCHRHCRSIRRRAGYCAGRLRLTCTCVR | Free | Free | None | Linear | 37 | L | Cationic | Natural | Derived from Haemaphysalis longicornis | Mycobacterium bovis | Mycobacterium bovis | MIC50 = 0.2 μM | In vitro | A549, 293 T, K562 and THP1 cells | NA | No cytotoxicity at 20 μM | NA | NA | NA | NA | NA | NA | Antiibacterial against Bacillus pumilus, Micrococcus luteus, Pseudomonas aeruginosa, Escherichia coli | 2017 | 28446822 |
| antitb_1967 | HIDFS2 | GFGCPLNQGACHRHCRSIRRRGGYCSGIIKQTCY | Free | Free | None | Linear | 34 | L | Cationic | Natural | Derived from Haemaphysalis longicornis | Mycobacterium bovis | Mycobacterium bovis | MIC50 = 0.5μM | In vitro | A549, 293 T, K562 and THP1 cells | NA | No cytotoxicity at 20 μM | NA | NA | NA | NA | NA | NA | Antiibacterial against Bacillus pumilus, Micrococcus luteus, Pseudomonas aeruginosa, Escherichia coli | 2017 | 28446822 |
| antitb_1968 | HIDFS1 | GFGCPFNARRCHRHCRSIRRRAGYCAGRLRLTCTCVR | Free | Free | None | Linear | 37 | L | Cationic | Natural | Derived from Haemaphysalis longicornis | Mycobacterium bovis | Mycobacterium bovis | MIC50 = 0.5 μM | In vitro | A549, 293 T, K562 and THP1 cells | NA | No cytotoxicity at 20 μM | NA | NA | NA | NA | NA | NA | Antiibacterial against Bacillus pumilus, Micrococcus luteus, Pseudomonas aeruginosa, Escherichia coli | 2017 | 28446822 |
| antitb_1969 | HIDFS2 | GFGCPLNQGACHRHCRSIRRRGGYCSGIIKQTCY | Free | Free | None | Linear | 34 | L | Cationic | Natural | Derived from Haemaphysalis longicornis | Mycobacterium bovis | Mycobacterium bovis | MIC50 = 0.5μM | In vitro | A549, 293 T, K562 and THP1 cells | NA | No cytotoxicity at 20 μM | NA | NA | NA | NA | NA | NA | Antiibacterial against Bacillus pumilus, Micrococcus luteus, Pseudomonas aeruginosa, Escherichia coli | 2017 | 28446822 |