Primary information |
---|
ID | antitb_1967, |
Name | 28446822 |
N-Terminal modification | HIDFS2 |
C-Terminal Modification | GFGCPLNQGACHRHCRSIRRRGGYCSGIIKQTCY |
Chemical Modification | Free |
Linear/Cyclic | Free |
Length | None |
Chirality | Linear |
Nature | 34 |
Source | L |
Origin | Cationic |
Species | Natural |
Strain | Derived from Haemaphysalis longicornis |
Inhibition Concentration | Mycobacterium bovis |
In Vitro/ In vivo | Mycobacterium bovis |
Cell Line | MIC50 = 0.5μM |
Inhibition Concentration | In vitro |
Sequence | 2017 |
Cytotoxicity | A549, 293 T, K562 and THP1 cells |
In vivo Model | NA |
Lethal Dose | No cytotoxicity at 20 μM |
Immune Responce | NA |
Mechanism of Action | NA |
Target | NA |
Combination Therapy | NA |
Other activities | NA |
PMID | NA |
Year of Publication | Antiibacterial against Bacillus pumilus, Micrococcus luteus, Pseudomonas aeruginosa, Escherichia coli |
Tertiary Structure (Technique) | Not Predicted), |
Primary information |
---|
ID | antitb_1969, |
Name | 28446822 |
N-Terminal modification | HIDFS2 |
C-Terminal Modification | GFGCPLNQGACHRHCRSIRRRGGYCSGIIKQTCY |
Chemical Modification | Free |
Linear/Cyclic | Free |
Length | None |
Chirality | Linear |
Nature | 34 |
Source | L |
Origin | Cationic |
Species | Natural |
Strain | Derived from Haemaphysalis longicornis |
Inhibition Concentration | Mycobacterium bovis |
In Vitro/ In vivo | Mycobacterium bovis |
Cell Line | MIC50 = 0.5μM |
Inhibition Concentration | In vitro |
Sequence | 2017 |
Cytotoxicity | A549, 293 T, K562 and THP1 cells |
In vivo Model | NA |
Lethal Dose | No cytotoxicity at 20 μM |
Immune Responce | NA |
Mechanism of Action | NA |
Target | NA |
Combination Therapy | NA |
Other activities | NA |
PMID | NA |
Year of Publication | Antiibacterial against Bacillus pumilus, Micrococcus luteus, Pseudomonas aeruginosa, Escherichia coli |
Tertiary Structure (Technique) | Not Predicted), |