Browse result page of PRRDB 2.0

PRRID	Name of Ligand	Source of ligand	Sequence of Ligand	Length of Ligand	Type of Ligand	Occurence	Role of Ligand	Name of Receptor	Type of Reeptor	Source of the Receptor	Localization	Domain	Sequence of Receptor	Swiss prot ID	Length of receptor	Function of Receptor	Assay used	PMID	Year of publication	Pubchem assay
PRRID_0233	3M-001 Click for more detail	small chemical derivatives (others)	NA	NA	imidazoquinolines	Synthetic	elicit innate immune response	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Human	dendritic cells	NA	Q9NYK1.fasta	Q9NYK1	1049	production of pro-inflammatory cytokines	NA	17114492	2006	Pubchem Assay
PRRID_0233	3M-001 Click for more detail	small chemical derivatives (others)	NA	NA	imidazoquinolines	Synthetic	elicit innate immune response	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Human	dendritic cells	NA	Q9NYK1.fasta	Q9NYK1	1049	production of pro-inflammatory cytokines	NA	17114492	2006	Pubchem Assay
PRRID_0235	3M-002 Click for more detail	small chemical derivatives (others)	NA	NA	imidazoquinolines	Synthetic	elicit innate immune response	Toll-like receptor 8 (TLR8)	Toll-like receptor (TLR)	Human	dendritic cells	NA	Q9NR97.fasta	Q9NR97	1041	production of pro-inflammatory cytokines	NA	17114492	2006	Pubchem Assay
PRRID_0235	3M-002 Click for more detail	small chemical derivatives (others)	NA	NA	imidazoquinolines	Synthetic	elicit innate immune response	Toll-like receptor 8 (TLR8)	Toll-like receptor (TLR)	Human	dendritic cells	NA	Q9NR97.fasta	Q9NR97	1041	production of pro-inflammatory cytokines	NA	17114492	2006	Pubchem Assay
PRRID_0239	Apoptotic cells Click for more detail	Endogenous (others)	NA	NA	Others	Natural	Immunostimulant	cluster of differentiation 36 (CD36)	Pattern recognition receptor (PRR)	Human	NA	transmembrane domains, contains both a ‚Äòneck‚Äô domain and the C-type lectin fold.	P16671.fasta	P16671	472	NA	Protein lipid overlay assay	16146427	2006	Pubchem Assay
PRRID_0239	Apoptotic cells Click for more detail	Endogenous (others)	NA	NA	Others	Natural	Immunostimulant	cluster of differentiation 36 (CD36)	Pattern recognition receptor (PRR)	Human	NA	transmembrane domains, contains both a ‚Äòneck‚Äô domain and the C-type lectin fold.	P16671.fasta	P16671	472	NA	Protein lipid overlay assay	16146427	2006	Pubchem Assay
PRRID_0246	Lipopolysaccharide (LPS) Click for more detail	Gram-negative bacteria	CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC	NA	Lipopolysaccharide (LPS)	Natural	Immunostimulant	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	NA	NA	O60603.fasta	O60603	784	NA	NA	16861291	2006	Pubchem Assay
PRRID_0246	Lipopolysaccharide (LPS) Click for more detail	Gram-negative bacteria	CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC	NA	Lipopolysaccharide (LPS)	Natural	Immunostimulant	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	NA	NA	O60603.fasta	O60603	784	NA	NA	16861291	2006	Pubchem Assay
PRRID_0250	Small Heat Shock Protein B8 (HSP22) Click for more detail	Host (Endogenous) (others)	MADGQMPFSCHYPSRLRRDPFRDSPLSSRLLDDGFGMDPFPDDLTASWPDWALPRLSSAWPGTLRSGMVPRGPTATARFGVPAEGRTPPPFPGEPWKVCVNVHSFKPEELMVKTKDGYVEVSGKHEEKQQEGGIVSKNFTKKIQLPAEVDPVTVFASLSPEGLLIIEAPQVPPYSTFGESSFNNELPQDSQEVTCT	496	Protein	Natural	It leads to the increased production of the inflammatory mediators TNF-alpha, IL-6, IL-10, and IL-12p70.	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	Synovial tissue	NA	O00206.fasta	O00206	839	It leads to the activationa and maturation of the dendritic cells	Cyokine assay	16709864	2006	Pubchem Assay
PRRID_0250	Small Heat Shock Protein B8 (HSP22) Click for more detail	Host (Endogenous) (others)	MADGQMPFSCHYPSRLRRDPFRDSPLSSRLLDDGFGMDPFPDDLTASWPDWALPRLSSAWPGTLRSGMVPRGPTATARFGVPAEGRTPPPFPGEPWKVCVNVHSFKPEELMVKTKDGYVEVSGKHEEKQQEGGIVSKNFTKKIQLPAEVDPVTVFASLSPEGLLIIEAPQVPPYSTFGESSFNNELPQDSQEVTCT	496	Protein	Natural	It leads to the increased production of the inflammatory mediators TNF-alpha, IL-6, IL-10, and IL-12p70.	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	Synovial tissue	NA	O00206.fasta	O00206	839	It leads to the activationa and maturation of the dendritic cells	Cyokine assay	16709864	2006	Pubchem Assay
PRRID_0260	N-ALP1 Click for more detail	Mycoplasma pneumoniae (Bacteria)	NA	NA	Lipoprotein	Natural	It induces the activation of NF-kappaB and induces the expression levels of interleukin-6 (IL-6) and tumour necrosis factor-alpha (TNF-alpha).	Toll-like receptor 1/2 (TLR1/2)	Toll-like receptor (TLR)	Human	human kidney cell line, 293T	NA	NA	NA	NA	It has the role in immuno inflammation.	Transfection and luciferase assay	17433078	2007	NA
PRRID_0260	N-ALP1 Click for more detail	Mycoplasma pneumoniae (Bacteria)	NA	NA	Lipoprotein	Natural	It induces the activation of NF-kappaB and induces the expression levels of interleukin-6 (IL-6) and tumour necrosis factor-alpha (TNF-alpha).	Toll-like receptor 1/2 (TLR1/2)	Toll-like receptor (TLR)	Human	human kidney cell line, 293T	NA	NA	NA	NA	It has the role in immuno inflammation.	Transfection and luciferase assay	17433078	2007	NA
PRRID_0261	N-ALP2 Click for more detail	Mycoplasma pneumoniae (Bacteria)	NA	NA	Lipoprotein	Natural	It induces the activation of NF-kappaB and induces the expression levels of interleukin-6 (IL-6) and tumour necrosis factor-alpha (TNF-alpha).	Toll-like receptor 1/2 (TLR1/2)	Toll-like receptor (TLR)	Human	human kidney cell line, 293T	NA	NA	NA	NA	It has the role in immuno inflammation.	Transfection and luciferase assay	17433078	2007	NA
PRRID_0261	N-ALP2 Click for more detail	Mycoplasma pneumoniae (Bacteria)	NA	NA	Lipoprotein	Natural	It induces the activation of NF-kappaB and induces the expression levels of interleukin-6 (IL-6) and tumour necrosis factor-alpha (TNF-alpha).	Toll-like receptor 1/2 (TLR1/2)	Toll-like receptor (TLR)	Human	human kidney cell line, 293T	NA	NA	NA	NA	It has the role in immuno inflammation.	Transfection and luciferase assay	17433078	2007	NA
PRRID_0263	polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail	NA	C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O	NA	Nucleic Acid	Synthetic	elicit innate immune response	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	Human	macrophages and dendritic cells	NA	O15455.fasta	O15455	904	Induces pro-inflammatory cytokine response	NA	17573354	2007	Pubchem Assay
PRRID_0263	polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail	NA	C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O	NA	Nucleic Acid	Synthetic	elicit innate immune response	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	Human	macrophages and dendritic cells	NA	O15455.fasta	O15455	904	Induces pro-inflammatory cytokine response	NA	17573354	2007	Pubchem Assay
PRRID_0266	3M-003 Click for more detail	NA	NA	NA	Nucleic Acid	Synthetic	Stimulation leads to the increased gene expression of cytokines and chemokines such as, IL-6, MIP1 alpha, MIP1 beta, TNF alpha, and LTA.	Toll-like receptor 7/8 (TLR7/8)	Toll-like receptor (TLR)	Human	B cells and pDC	NA	NA	NA	NA	It induces changes in gene expression and protein production that effect B cell function such as, Cell Migration, Signal Transduction, Proliferation, Differentiation and Survival.	ELISA	18652679	2008	NA
PRRID_0266	3M-003 Click for more detail	NA	NA	NA	Nucleic Acid	Synthetic	Stimulation leads to the increased gene expression of cytokines and chemokines such as, IL-6, MIP1 alpha, MIP1 beta, TNF alpha, and LTA.	Toll-like receptor 7/8 (TLR7/8)	Toll-like receptor (TLR)	Human	B cells and pDC	NA	NA	NA	NA	It induces changes in gene expression and protein production that effect B cell function such as, Cell Migration, Signal Transduction, Proliferation, Differentiation and Survival.	ELISA	18652679	2008	NA
PRRID_0268	852A Click for more detail	NA	CCCC=CC=CC(=O)NC(CC(=O)N)C(=O)NC(CC(=O)N)C(=O)NC(C1CCC(CC1)O)C(=O)NC(CCCN)C(=O)NC(C(C)O)C(=O)NC(C2CCC(CC2)O)C(=O)NC(C3CCC(CC3)O)C(=O)NC(C(C)O)C(=O)NC(CC4=CC=CC=C4)C(=O)NC(CCCN)C(=O)NC(C5CCC(CC5)O)C(=O)NC(C(C)O)C(=O)NC(C6CCC(CC6)O)C(=O)NCC(=O)NC(CC(C)C)C(=O)NC(C)C(=O)NC(C7CCC(C(C7)Cl)O)C(=O)O	NA	Nucleic Acid	Synthetic	It has stimulated the production of interferon-‚ç∫ (IFN-‚ç∫), IFN-inducible protein-10 (IP-10), interleukin-1 receptor antagonist (IL-1Ra), monocyte chemotactic protein-1 (MCP-1), and tumor necrosis factor-related apoptosis-inducing ligand (TRAIL),IL-12p70, IL-18, and IFN-	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Human	Peripheral blood mononuclear cells (PBMC)	LRR	Q9NYK1.fasta	Q9NYK1	1049	It has inhibited the proliferation of tumor cell lines Hs294T and 769-P.	ELISA	18439103	2008	Pubchem Assay
PRRID_0268	852A Click for more detail	NA	CCCC=CC=CC(=O)NC(CC(=O)N)C(=O)NC(CC(=O)N)C(=O)NC(C1CCC(CC1)O)C(=O)NC(CCCN)C(=O)NC(C(C)O)C(=O)NC(C2CCC(CC2)O)C(=O)NC(C3CCC(CC3)O)C(=O)NC(C(C)O)C(=O)NC(CC4=CC=CC=C4)C(=O)NC(CCCN)C(=O)NC(C5CCC(CC5)O)C(=O)NC(C(C)O)C(=O)NC(C6CCC(CC6)O)C(=O)NCC(=O)NC(CC(C)C)C(=O)NC(C)C(=O)NC(C7CCC(C(C7)Cl)O)C(=O)O	NA	Nucleic Acid	Synthetic	It has stimulated the production of interferon-‚ç∫ (IFN-‚ç∫), IFN-inducible protein-10 (IP-10), interleukin-1 receptor antagonist (IL-1Ra), monocyte chemotactic protein-1 (MCP-1), and tumor necrosis factor-related apoptosis-inducing ligand (TRAIL),IL-12p70, IL-18, and IFN-	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Human	Peripheral blood mononuclear cells (PBMC)	LRR	Q9NYK1.fasta	Q9NYK1	1049	It has inhibited the proliferation of tumor cell lines Hs294T and 769-P.	ELISA	18439103	2008	Pubchem Assay
PRRID_0269	852A Click for more detail	NA	CCCC=CC=CC(=O)NC(CC(=O)N)C(=O)NC(CC(=O)N)C(=O)NC(C1CCC(CC1)O)C(=O)NC(CCCN)C(=O)NC(C(C)O)C(=O)NC(C2CCC(CC2)O)C(=O)NC(C3CCC(CC3)O)C(=O)NC(C(C)O)C(=O)NC(CC4=CC=CC=C4)C(=O)NC(CCCN)C(=O)NC(C5CCC(CC5)O)C(=O)NC(C(C)O)C(=O)NC(C6CCC(CC6)O)C(=O)NCC(=O)NC(CC(C)C)C(=O)NC(C)C(=O)NC(C7CCC(C(C7)Cl)O)C(=O)O	NA	Nucleic Acid	Synthetic	Stimulation leads to the increased gene expression of cytokines and chemokines such as, IL-6, MIP1 alpha, MIP1 beta, TNF alpha, and LTA.	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Human	B cells and pDC	NA	Q9NYK1.fasta	Q9NYK1	1049	It induces changes in gene expression and protein production that effect B cell function such as, Cell Migration, Signal Transduction, Proliferation, Differentiation and Survival.	ELISA	18652679	2008	Pubchem Assay
PRRID_0269	852A Click for more detail	NA	CCCC=CC=CC(=O)NC(CC(=O)N)C(=O)NC(CC(=O)N)C(=O)NC(C1CCC(CC1)O)C(=O)NC(CCCN)C(=O)NC(C(C)O)C(=O)NC(C2CCC(CC2)O)C(=O)NC(C3CCC(CC3)O)C(=O)NC(C(C)O)C(=O)NC(CC4=CC=CC=C4)C(=O)NC(CCCN)C(=O)NC(C5CCC(CC5)O)C(=O)NC(C(C)O)C(=O)NC(C6CCC(CC6)O)C(=O)NCC(=O)NC(CC(C)C)C(=O)NC(C)C(=O)NC(C7CCC(C(C7)Cl)O)C(=O)O	NA	Nucleic Acid	Synthetic	Stimulation leads to the increased gene expression of cytokines and chemokines such as, IL-6, MIP1 alpha, MIP1 beta, TNF alpha, and LTA.	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Human	B cells and pDC	NA	Q9NYK1.fasta	Q9NYK1	1049	It induces changes in gene expression and protein production that effect B cell function such as, Cell Migration, Signal Transduction, Proliferation, Differentiation and Survival.	ELISA	18652679	2008	Pubchem Assay
PRRID_0271	AM3 Click for more detail	Immunomodulatory drug (others)	NA	NA	Glycoconjugate	Synthetic	AM3 induces NF-kB activation, IkB-a degradation and MAPK phosphorylationand enhanced the expression of CD54, CD83, CD86, HLA-DR, chemokines and chemokine receptors, interleukin (IL)-12p70 and IL-10.	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	Monocytederived Dendritic cells (MDDCs)	LRR	O00206.fasta	O00206	839	AM3 induces human MDDC maturation, enhance and activates the T-cell proliferation and promotes MDDC maturation in patients with chronic HCV infection.	ELISA	18414382	2008	Pubchem Assay
PRRID_0271	AM3 Click for more detail	Immunomodulatory drug (others)	NA	NA	Glycoconjugate	Synthetic	AM3 induces NF-kB activation, IkB-a degradation and MAPK phosphorylationand enhanced the expression of CD54, CD83, CD86, HLA-DR, chemokines and chemokine receptors, interleukin (IL)-12p70 and IL-10.	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	Monocytederived Dendritic cells (MDDCs)	LRR	O00206.fasta	O00206	839	AM3 induces human MDDC maturation, enhance and activates the T-cell proliferation and promotes MDDC maturation in patients with chronic HCV infection.	ELISA	18414382	2008	Pubchem Assay
PRRID_0274	Cardioprotectant adenosine Click for more detail	NA	NA	NA	Nucleic Acid	Natural	Adenosine increases matrix metalloproteinase-9 production by primary macrophages from healthy volunteers and myocardial infarction patients.	Adenosine-A3 receptor	G-protein-coupled receptors (GPCR)	Human	PBMCs	NA	P0DMS8.fasta	P0DMS8	318	It improves the revascularization.	ELISA	18653544	2008	Pubchem Assay
PRRID_0274	Cardioprotectant adenosine Click for more detail	NA	NA	NA	Nucleic Acid	Natural	Adenosine increases matrix metalloproteinase-9 production by primary macrophages from healthy volunteers and myocardial infarction patients.	Adenosine-A3 receptor	G-protein-coupled receptors (GPCR)	Human	PBMCs	NA	P0DMS8.fasta	P0DMS8	318	It improves the revascularization.	ELISA	18653544	2008	Pubchem Assay
PRRID_0275	Chlamydia trachomatis Click for more detail	Chlamydia trachomatis(Bacteria)	NA	NA	Whole organism	Natural	Chlamydia trachomatis infection leads to up-regulation of inflammatory IL-8.	Nucleotide Binding Oligomerization Domain Containing 1 (Nod1)	NOD-like receptor (NLR)	Human	HeLa 229 epithelial cells	LRR	Q9Y239.fasta	Q9Y239	953	NOD1 and RIP2 activation is needed for the IL-8 response to C. trachomatis infection.	ELISA	18426885	2008	Pubchem Assay
PRRID_0275	Chlamydia trachomatis Click for more detail	Chlamydia trachomatis(Bacteria)	NA	NA	Whole organism	Natural	Chlamydia trachomatis infection leads to up-regulation of inflammatory IL-8.	Nucleotide Binding Oligomerization Domain Containing 1 (Nod1)	NOD-like receptor (NLR)	Human	HeLa 229 epithelial cells	LRR	Q9Y239.fasta	Q9Y239	953	NOD1 and RIP2 activation is needed for the IL-8 response to C. trachomatis infection.	ELISA	18426885	2008	Pubchem Assay
PRRID_0279	CpG2006 Click for more detail	NA	5‚Äô-tcgtcgttttgtcgttttgtcgtt-3‚Äô	24	Nucleic Acid	Synthetic	Stimulation leads to the increased gene expression of cytokines and chemokines such as, IL-6, MIP1 alpha, MIP1 beta, TNF alpha, and LTA.	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Human	B cells and pDC	NA	Q9NR96.fasta	Q9NR96	1032	It induces changes in gene expression and protein production that effect B cell function such as, Cell Migration, Signal Transduction, Proliferation, Differentiation and Survival.	ELISA	18652679	2008	Pubchem Assay
PRRID_0279	CpG2006 Click for more detail	NA	5‚Äô-tcgtcgttttgtcgttttgtcgtt-3‚Äô	24	Nucleic Acid	Synthetic	Stimulation leads to the increased gene expression of cytokines and chemokines such as, IL-6, MIP1 alpha, MIP1 beta, TNF alpha, and LTA.	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Human	B cells and pDC	NA	Q9NR96.fasta	Q9NR96	1032	It induces changes in gene expression and protein production that effect B cell function such as, Cell Migration, Signal Transduction, Proliferation, Differentiation and Survival.	ELISA	18652679	2008	Pubchem Assay
PRRID_0280	Curdlan Click for more detail	Alcaligenes faecalis(Bacteria)	C(C1C(C(C(C(O1)O)O)O)O)O	NA	Glucan	Natural	Curdlan is a pure dectin-1 agonist and induces TNF-alpha production in human PBMCs and macrophages.	Dectin-1	C type Lectin (CTL/CLR)	Human	PBMCs and monocyte-derived macrophages.	NA	Q9BXN2.fasta	Q9BXN2	247	It is resoonsible for the immuno-inflammation in the host cell.	ELISA	18549457	2008	Pubchem Assay
PRRID_0280	Curdlan Click for more detail	Alcaligenes faecalis(Bacteria)	C(C1C(C(C(C(O1)O)O)O)O)O	NA	Glucan	Natural	Curdlan is a pure dectin-1 agonist and induces TNF-alpha production in human PBMCs and macrophages.	Dectin-1	C type Lectin (CTL/CLR)	Human	PBMCs and monocyte-derived macrophages.	NA	Q9BXN2.fasta	Q9BXN2	247	It is resoonsible for the immuno-inflammation in the host cell.	ELISA	18549457	2008	Pubchem Assay
PRRID_0281	dsRNA Click for more detail	Virus	NA	NA	Nucleic Acid	Natural	initiate intracellular signaling cascades that may lead to host inflammation.	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	Human	basal epithelial layer.	Leucine-rich Repeat (LRR) Domain	O15455.fasta	O15455	904	NA	immunohistochemistry	18793367	2008	Pubchem Assay
PRRID_0281	dsRNA Click for more detail	Virus	NA	NA	Nucleic Acid	Natural	initiate intracellular signaling cascades that may lead to host inflammation.	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	Human	basal epithelial layer.	Leucine-rich Repeat (LRR) Domain	O15455.fasta	O15455	904	NA	immunohistochemistry	18793367	2008	Pubchem Assay
PRRID_0287	FTT1103 Click for more detail	Mycoplasma pneumoniae (Bacteria)	NA	NA	Lipoprotein	Natural	Immunostimulant	Toll-like receptor 2 (TLR2)/Toll-like receptor (TLR1	Toll-like receptor (TLR)	Human	NA	NA	NA	NA	NA	capable of stimulating a proinflammatory response and the cellular receptors they trigger	NA	18079113	2008	NA
PRRID_0287	FTT1103 Click for more detail	Mycoplasma pneumoniae (Bacteria)	NA	NA	Lipoprotein	Natural	Immunostimulant	Toll-like receptor 2 (TLR2)/Toll-like receptor (TLR1	Toll-like receptor (TLR)	Human	NA	NA	NA	NA	NA	capable of stimulating a proinflammatory response and the cellular receptors they trigger	NA	18079113	2008	NA
PRRID_0291	German Cockroach frass Click for more detail	German Cockroach (others)	NA	NA	Allergen	Natural	It induced NF-Œ∫B translocation and DNA binding, which leads to the secretions of cytokines, such as TNF-‚ç∫ and IL-8.	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	Primary human neutrophils	LRR	O60603.fasta	O60603	784	It is responisble for the immune response against the allergen having origin as German Cockroach frass.	ELISA	18424755	2008	Pubchem Assay
PRRID_0291	German Cockroach frass Click for more detail	German Cockroach (others)	NA	NA	Allergen	Natural	It induced NF-Œ∫B translocation and DNA binding, which leads to the secretions of cytokines, such as TNF-‚ç∫ and IL-8.	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	Primary human neutrophils	LRR	O60603.fasta	O60603	784	It is responisble for the immune response against the allergen having origin as German Cockroach frass.	ELISA	18424755	2008	Pubchem Assay
PRRID_0293	Hantaan virus (HTNV) Click for more detail	Hantaan virus (HTNV) (Virus)	NA	NA	Whole organism	Natural	HTNV infection induces IFN-Œ≤, IL-6 and TNF-Œ± expression.	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	Endothelial vein cells (EVC-304)	LRR	O00206.fasta	O00206	839	TLR4 is a potential factor in HFRS pathogenesis.	ELISA	18707748	2008	Pubchem Assay
PRRID_0293	Hantaan virus (HTNV) Click for more detail	Hantaan virus (HTNV) (Virus)	NA	NA	Whole organism	Natural	HTNV infection induces IFN-Œ≤, IL-6 and TNF-Œ± expression.	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	Endothelial vein cells (EVC-304)	LRR	O00206.fasta	O00206	839	TLR4 is a potential factor in HFRS pathogenesis.	ELISA	18707748	2008	Pubchem Assay
PRRID_0298	Imiquimod Click for more detail	NA	CC(C)CN1C=NC2=C1C3=CC=CC=C3N=C2N	NA	Nucleic Acid	Synthetic	imiquimod leads to decreased tyrosinase and MITF expression and is accompanied by decreased pigmentation.	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Human	Melanocytes	NA	Q9NYK1.fasta	Q9NYK1	1049	It inhibits Melanogenesis and Proliferation of Human Melanocytes.	NA	18596825	2008	Pubchem Assay
PRRID_0298	Imiquimod Click for more detail	NA	CC(C)CN1C=NC2=C1C3=CC=CC=C3N=C2N	NA	Nucleic Acid	Synthetic	imiquimod leads to decreased tyrosinase and MITF expression and is accompanied by decreased pigmentation.	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Human	Melanocytes	NA	Q9NYK1.fasta	Q9NYK1	1049	It inhibits Melanogenesis and Proliferation of Human Melanocytes.	NA	18596825	2008	Pubchem Assay
PRRID_0302	Lipid A Click for more detail	Burkholderia pseudomallei(Bacteria)	CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC	NA	Lipid	Natural	Stimulation via LPS leads to the activation of NF-KappaB, which resulted into the production of TNF-Œ±, MIP-2, and IL-10.	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	HEK293 cells	LRR	O00206.fasta	O00206	839	It has a immunostimulatory role	ELISA	18691413	2008	Pubchem Assay
PRRID_0302	Lipid A Click for more detail	Burkholderia pseudomallei(Bacteria)	CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC	NA	Lipid	Natural	Stimulation via LPS leads to the activation of NF-KappaB, which resulted into the production of TNF-Œ±, MIP-2, and IL-10.	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	HEK293 cells	LRR	O00206.fasta	O00206	839	It has a immunostimulatory role	ELISA	18691413	2008	Pubchem Assay
PRRID_0305	Lipopolysaccharide (LPS) Click for more detail	E. coli 055:B5(Bacteria)	CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC	NA	Lipopolysaccharide (LPS)	Natural	LPS promotes TGFb1 and VEGF production in human prostate epithelial PC3 cells and also LPS stimulation, leads to the increased expression of NF-KB p65 protein.	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	Human prostate epithelial PC3 cells	LRR	O00206.fasta	O00206	839	It plays important roles in promoting prostate cancer immune escape, survival, progression, and metastasis by inducing immunosuppressive and proangiogenic cytokines.	ELISA	18649875	2008	Pubchem Assay
PRRID_0305	Lipopolysaccharide (LPS) Click for more detail	E. coli 055:B5(Bacteria)	CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC	NA	Lipopolysaccharide (LPS)	Natural	LPS promotes TGFb1 and VEGF production in human prostate epithelial PC3 cells and also LPS stimulation, leads to the increased expression of NF-KB p65 protein.	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	Human prostate epithelial PC3 cells	LRR	O00206.fasta	O00206	839	It plays important roles in promoting prostate cancer immune escape, survival, progression, and metastasis by inducing immunosuppressive and proangiogenic cytokines.	ELISA	18649875	2008	Pubchem Assay
PRRID_0308	Lipopolysaccharide (LPS) Click for more detail	Burkholderia pseudomallei(Bacteria)	CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC	NA	Lipopolysaccharide (LPS)	Natural	Stimulation via LPS leads to the activation of NF-KappaB, which resulted into the production of TNF-Œ±, MIP-2, and IL-10.	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	HEK293 cells	LRR	O00206.fasta	O00206	839	It has a immunostimulatory role	ELISA	18691413	2008	Pubchem Assay
PRRID_0308	Lipopolysaccharide (LPS) Click for more detail	Burkholderia pseudomallei(Bacteria)	CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC	NA	Lipopolysaccharide (LPS)	Natural	Stimulation via LPS leads to the activation of NF-KappaB, which resulted into the production of TNF-Œ±, MIP-2, and IL-10.	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	HEK293 cells	LRR	O00206.fasta	O00206	839	It has a immunostimulatory role	ELISA	18691413	2008	Pubchem Assay
PRRID_0311	Lipoprotein Click for more detail	Ureaplasma parvum (Bacteria)	NA	NA	Lipoprotein	Natural	Upon ligand engagement TLR proteins trigger downstream cellular signaling, leads to the activation of NF-	Toll-like receptor 1 (TLR1)	Toll-like receptor (TLR)	Human	Kidney cell line, 293T	LRR	Q15399.fasta	Q15399	786	This induces the inflammatory response.	ELISA	18451040	2008	Pubchem Assay
PRRID_0311	Lipoprotein Click for more detail	Ureaplasma parvum (Bacteria)	NA	NA	Lipoprotein	Natural	Upon ligand engagement TLR proteins trigger downstream cellular signaling, leads to the activation of NF-	Toll-like receptor 1 (TLR1)	Toll-like receptor (TLR)	Human	Kidney cell line, 293T	LRR	Q15399.fasta	Q15399	786	This induces the inflammatory response.	ELISA	18451040	2008	Pubchem Assay
PRRID_0312	Lipoprotein Click for more detail	Ureaplasma parvum (Bacteria)	NA	NA	Lipoprotein	Natural	Upon ligand engagement TLR proteins trigger downstream cellular signaling, leads to the activation of NF-	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	Kidney cell line, 293T	LRR	O60603.fasta	O60603	784	This induces the inflammatory response.	ELISA	18451040	2008	Pubchem Assay
PRRID_0312	Lipoprotein Click for more detail	Ureaplasma parvum (Bacteria)	NA	NA	Lipoprotein	Natural	Upon ligand engagement TLR proteins trigger downstream cellular signaling, leads to the activation of NF-	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	Kidney cell line, 293T	LRR	O60603.fasta	O60603	784	This induces the inflammatory response.	ELISA	18451040	2008	Pubchem Assay
PRRID_0313	Lipoprotein Click for more detail	Ureaplasma parvum (Bacteria)	NA	NA	Lipoprotein	Natural	Upon ligand engagement TLR proteins trigger downstream cellular signaling, leads to the activation of NF-	Toll-like receptor 6 (TLR6)	Toll-like receptor (TLR)	Human	Kidney cell line, 293T	LRR	Q9Y2C9.fasta	Q9Y2C9	796	This induces the inflammatory response.	ELISA	18451040	2008	Pubchem Assay
PRRID_0313	Lipoprotein Click for more detail	Ureaplasma parvum (Bacteria)	NA	NA	Lipoprotein	Natural	Upon ligand engagement TLR proteins trigger downstream cellular signaling, leads to the activation of NF-	Toll-like receptor 6 (TLR6)	Toll-like receptor (TLR)	Human	Kidney cell line, 293T	LRR	Q9Y2C9.fasta	Q9Y2C9	796	This induces the inflammatory response.	ELISA	18451040	2008	Pubchem Assay
PRRID_0316	Lipoteichoic Acid (LTA) Click for more detail	Bacillus subtilis(Bacteria)	C(C1C(C(C(C(O1)OCC(CO)O)OC2C(C(C(C(O2)COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(CO)O)O)O)O)O)O)O)O)O)O	NA	Amphiphile	Natural	LTA-treated LEC increases the expression of E-selectin, ICAM-1, and VCAM-1, moreover it induces the expression of CCL2, CCL5, and CCL20 (Cys-Cys motif chemokines) and of CXCL1, CXCL3, CXCL5, CXCL6, and CXCL8 (Cys-X-Cys motif chemokines).	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	Cultured human lymphatic endothelium (LEC)	LRR	O60603.fasta	O60603	784	It has a immunostimulatory role	ELISA	18523807	2008	Pubchem Assay
PRRID_0316	Lipoteichoic Acid (LTA) Click for more detail	Bacillus subtilis(Bacteria)	C(C1C(C(C(C(O1)OCC(CO)O)OC2C(C(C(C(O2)COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(CO)O)O)O)O)O)O)O)O)O)O	NA	Amphiphile	Natural	LTA-treated LEC increases the expression of E-selectin, ICAM-1, and VCAM-1, moreover it induces the expression of CCL2, CCL5, and CCL20 (Cys-Cys motif chemokines) and of CXCL1, CXCL3, CXCL5, CXCL6, and CXCL8 (Cys-X-Cys motif chemokines).	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	Cultured human lymphatic endothelium (LEC)	LRR	O60603.fasta	O60603	784	It has a immunostimulatory role	ELISA	18523807	2008	Pubchem Assay
PRRID_0320	Low Molecular Weight Hyaluronic Acid (LMW-HA) Click for more detail	Host (Endogenous) (others)	CC(=O)NC1CC(C(OC1OC2C(C(C(OC2C(=O)[O-])O)O)O)CO)O	NA	Glycosaminoglycan	Natural	It leads to the production of antimicrobial peptide beta defensins 2.	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	Keratinocytes NCTC 2544 cell line	NA	O60603.fasta	O60603	784	It leadsto the induction of an antibacterial response.	ELISA	18641349	2008	Pubchem Assay
PRRID_0320	Low Molecular Weight Hyaluronic Acid (LMW-HA) Click for more detail	Host (Endogenous) (others)	CC(=O)NC1CC(C(OC1OC2C(C(C(OC2C(=O)[O-])O)O)O)CO)O	NA	Glycosaminoglycan	Natural	It leads to the production of antimicrobial peptide beta defensins 2.	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	Keratinocytes NCTC 2544 cell line	NA	O60603.fasta	O60603	784	It leadsto the induction of an antibacterial response.	ELISA	18641349	2008	Pubchem Assay
PRRID_0321	Low Molecular Weight Hyaluronic Acid (LMW-HA) Click for more detail	Host (Endogenous) (others)	CC(=O)NC1CC(C(OC1OC2C(C(C(OC2C(=O)[O-])O)O)O)CO)O	NA	Glycosaminoglycan	Natural	It leads to the production of antimicrobial peptide beta defensins 2.	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	Keratinocytes NCTC 2544 cell line	NA	O00206.fasta	O00206	839	It leadsto the induction of an antibacterial response.	ELISA	18641349	2008	Pubchem Assay
PRRID_0321	Low Molecular Weight Hyaluronic Acid (LMW-HA) Click for more detail	Host (Endogenous) (others)	CC(=O)NC1CC(C(OC1OC2C(C(C(OC2C(=O)[O-])O)O)O)CO)O	NA	Glycosaminoglycan	Natural	It leads to the production of antimicrobial peptide beta defensins 2.	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	Keratinocytes NCTC 2544 cell line	NA	O00206.fasta	O00206	839	It leadsto the induction of an antibacterial response.	ELISA	18641349	2008	Pubchem Assay
PRRID_0322	Low Molecular Weight Hyaluronic Acid (LMW-HA) Click for more detail	Host (Endogenous) (others)	CC(=O)NC1CC(C(OC1OC2C(C(C(OC2C(=O)[O-])O)O)O)CO)O	NA	Glycosaminoglycan	Natural	It leads to the production of antimicrobial peptide beta defensins 2.	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	Dorsal skin	NA	O00206.fasta	O00206	839	It leadsto the induction of an antibacterial response.	ELISA	18641349	2008	Pubchem Assay
PRRID_0322	Low Molecular Weight Hyaluronic Acid (LMW-HA) Click for more detail	Host (Endogenous) (others)	CC(=O)NC1CC(C(OC1OC2C(C(C(OC2C(=O)[O-])O)O)O)CO)O	NA	Glycosaminoglycan	Natural	It leads to the production of antimicrobial peptide beta defensins 2.	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	Dorsal skin	NA	O00206.fasta	O00206	839	It leadsto the induction of an antibacterial response.	ELISA	18641349	2008	Pubchem Assay
PRRID_0327	MG149 Click for more detail	Mycoplasma genitalium (Bacteria)	CCCCCCCC1=CC=C(C=C1)CCC2=C(C(=CC=C2)O)C(=O)O	NA	Lipoprotein	Natural	On binding to the TLR2, it induces the activation of NF-	Toll-like receptor (TLR1 and Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	Kidney cell line, 293T	LRR	NA	NA	NA	It has a immunostimulatory role	ELISA	18474641	2008	NA
PRRID_0327	MG149 Click for more detail	Mycoplasma genitalium (Bacteria)	CCCCCCCC1=CC=C(C=C1)CCC2=C(C(=CC=C2)O)C(=O)O	NA	Lipoprotein	Natural	On binding to the TLR2, it induces the activation of NF-	Toll-like receptor (TLR1 and Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	Kidney cell line, 293T	LRR	NA	NA	NA	It has a immunostimulatory role	ELISA	18474641	2008	NA
PRRID_0338	polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail	NA	C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O	NA	Nucleic Acid	Synthetic	Stilmulation leads to the activation of the NF-KappaB.	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	Human	Primary Human Keratinocytes	NA	O15455.fasta	O15455	904	It is responsible for the antiviral defense status.	ELISA	18684960	2008	Pubchem Assay
PRRID_0338	polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail	NA	C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O	NA	Nucleic Acid	Synthetic	Stilmulation leads to the activation of the NF-KappaB.	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	Human	Primary Human Keratinocytes	NA	O15455.fasta	O15455	904	It is responsible for the antiviral defense status.	ELISA	18684960	2008	Pubchem Assay
PRRID_0339	polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail	NA	C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O	NA	Nucleic Acid	Synthetic	Stilmulation leads to the activation of the IRF3.	Protein Kinase R (PKR)	Cytosolic receptor	Human	Primary Human Keratinocytes	NA	NA	NA	NA	It is responsible for the antiviral defense status.	ELISA	18684960	2008	NA
PRRID_0339	polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail	NA	C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O	NA	Nucleic Acid	Synthetic	Stilmulation leads to the activation of the IRF3.	Protein Kinase R (PKR)	Cytosolic receptor	Human	Primary Human Keratinocytes	NA	NA	NA	NA	It is responsible for the antiviral defense status.	ELISA	18684960	2008	NA
PRRID_0340	polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail	NA	C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O	NA	Nucleic Acid	Synthetic	Stilmulation leads to the activation of the IRF3.	RIG-1	Rig-like receptor (RLR)	Human	Primary Human Keratinocytes	NA	O95786.fasta	O95786	925	It is responsible for the antiviral defense status.	ELISA	18684960	2008	Pubchem Assay
PRRID_0340	polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail	NA	C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O	NA	Nucleic Acid	Synthetic	Stilmulation leads to the activation of the IRF3.	RIG-1	Rig-like receptor (RLR)	Human	Primary Human Keratinocytes	NA	O95786.fasta	O95786	925	It is responsible for the antiviral defense status.	ELISA	18684960	2008	Pubchem Assay
PRRID_0341	polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail	NA	C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O	NA	Nucleic Acid	Synthetic	Stilmulation leads to the activation of the IRF3 and NF-	MDA5	Rig-like receptor (RLR)	Human	Primary Human Keratinocytes	NA	Q53TB6.fasta	Q53TB6	435	It is responsible for the antiviral defense status.	ELISA	18684960	2008	Pubchem Assay
PRRID_0341	polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail	NA	C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O	NA	Nucleic Acid	Synthetic	Stilmulation leads to the activation of the IRF3 and NF-	MDA5	Rig-like receptor (RLR)	Human	Primary Human Keratinocytes	NA	Q53TB6.fasta	Q53TB6	435	It is responsible for the antiviral defense status.	ELISA	18684960	2008	Pubchem Assay
PRRID_0342	polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail	NA	C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O	NA	Nucleic Acid	Synthetic	Poly(I:C) stimulate the secretion of cytokines and chemokines such as, IL-6, RANTES/CCL5 and MCP-1/CCL2.	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	Human	Mesothelial cells	NA	O15455.fasta	O15455	904	It leads to the inflammation and infection of mesothelial cells.	ELISA	19005739	2008	Pubchem Assay
PRRID_0342	polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail	NA	C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O	NA	Nucleic Acid	Synthetic	Poly(I:C) stimulate the secretion of cytokines and chemokines such as, IL-6, RANTES/CCL5 and MCP-1/CCL2.	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	Human	Mesothelial cells	NA	O15455.fasta	O15455	904	It leads to the inflammation and infection of mesothelial cells.	ELISA	19005739	2008	Pubchem Assay
PRRID_0343	polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail	NA	C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O	NA	Nucleic Acid	Synthetic	Poly(I:C) stimulate the secretion of cytokines and chemokines such as, IL-6, RANTES/CCL5 and MCP-1/CCL2.	RIG-1	Rig-like receptor (RLR)	Human	Mesothelial cells	NA	O95786.fasta	O95786	925	It leads to the inflammation and infection of mesothelial cells.	ELISA	19005739	2008	Pubchem Assay
PRRID_0343	polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail	NA	C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O	NA	Nucleic Acid	Synthetic	Poly(I:C) stimulate the secretion of cytokines and chemokines such as, IL-6, RANTES/CCL5 and MCP-1/CCL2.	RIG-1	Rig-like receptor (RLR)	Human	Mesothelial cells	NA	O95786.fasta	O95786	925	It leads to the inflammation and infection of mesothelial cells.	ELISA	19005739	2008	Pubchem Assay
PRRID_0344	polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail	NA	C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O	NA	Nucleic Acid	Synthetic	Poly(I:C) stimulate the secretion of cytokines and chemokines such as, IL-6, RANTES/CCL5 and MCP-1/CCL2.	MDA5	Rig-like receptor (RLR)	Human	Mesothelial cells	NA	Q53TB6.fasta	Q53TB6	435	It leads to the inflammation and infection of mesothelial cells.	ELISA	19005739	2008	Pubchem Assay
PRRID_0344	polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail	NA	C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O	NA	Nucleic Acid	Synthetic	Poly(I:C) stimulate the secretion of cytokines and chemokines such as, IL-6, RANTES/CCL5 and MCP-1/CCL2.	MDA5	Rig-like receptor (RLR)	Human	Mesothelial cells	NA	Q53TB6.fasta	Q53TB6	435	It leads to the inflammation and infection of mesothelial cells.	ELISA	19005739	2008	Pubchem Assay
PRRID_0345	SalP Click for more detail	Bacteria	NA	NA	Lipoprotein	Natural	Immunostimulant	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	human corneal epithelial	NA	O60603.fasta	O60603	784	NA	Western Blot analysis	18191935	2008	Pubchem Assay
PRRID_0345	SalP Click for more detail	Bacteria	NA	NA	Lipoprotein	Natural	Immunostimulant	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	human corneal epithelial	NA	O60603.fasta	O60603	784	NA	Western Blot analysis	18191935	2008	Pubchem Assay
PRRID_0346	single-stranded RNA Click for more detail	Virus	NA	NA	Nucleic Acid	Natural	initiate intracellular signaling cascades that may lead to host inflammation.	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Human	epithelial cells	Leucine-rich Repeat (LRR) Domain	Q9NYK1.fasta	Q9NYK1	1049	NA	immunohistochemistry	18793367	2008	Pubchem Assay
PRRID_0346	single-stranded RNA Click for more detail	Virus	NA	NA	Nucleic Acid	Natural	initiate intracellular signaling cascades that may lead to host inflammation.	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Human	epithelial cells	Leucine-rich Repeat (LRR) Domain	Q9NYK1.fasta	Q9NYK1	1049	NA	immunohistochemistry	18793367	2008	Pubchem Assay
PRRID_0347	single-stranded RNA Click for more detail	Virus	NA	NA	Nucleic Acid	Natural	initiate intracellular signaling cascades that may lead to host inflammation.	Toll-like receptor 8 (TLR8)	Toll-like receptor (TLR)	Human	epithelial cells	Leucine-rich Repeat (LRR) Domain	Q9NR97.fasta	Q9NR97	1041	NA	immunohistochemistry	18793367	2008	Pubchem Assay
PRRID_0347	single-stranded RNA Click for more detail	Virus	NA	NA	Nucleic Acid	Natural	initiate intracellular signaling cascades that may lead to host inflammation.	Toll-like receptor 8 (TLR8)	Toll-like receptor (TLR)	Human	epithelial cells	Leucine-rich Repeat (LRR) Domain	Q9NR97.fasta	Q9NR97	1041	NA	immunohistochemistry	18793367	2008	Pubchem Assay
PRRID_0349	Staphylococcus aureus Click for more detail	S. aureus (Bacteria)	NA	NA	Whole organism	Natural	S. aureus induces IL-8 and TNF-alpha release by CBMC.	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	Cord Blood-Derived Mast Cells (CBMC)	NA	O60603.fasta	O60603	784	S. aureus adheres to, invades, survives in, and stimulates human mast cells with the involvement of CD48 and TLR2.	ELISA	18644875	2008	Pubchem Assay
PRRID_0349	Staphylococcus aureus Click for more detail	S. aureus (Bacteria)	NA	NA	Whole organism	Natural	S. aureus induces IL-8 and TNF-alpha release by CBMC.	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	Cord Blood-Derived Mast Cells (CBMC)	NA	O60603.fasta	O60603	784	S. aureus adheres to, invades, survives in, and stimulates human mast cells with the involvement of CD48 and TLR2.	ELISA	18644875	2008	Pubchem Assay
PRRID_0351	TUL4 Click for more detail	Mycoplasma pneumoniae (Bacteria)	NA	NA	Lipoprotein	Natural	Immunostimulant	Toll-like receptor 2 (TLR2)/Toll-like receptor (TLR1	Toll-like receptor (TLR)	Human	NA	NA	NA	NA	NA	capable of stimulating a proinflammatory response and the cellular receptors they trigger	NA	18079113	2008	NA
PRRID_0351	TUL4 Click for more detail	Mycoplasma pneumoniae (Bacteria)	NA	NA	Lipoprotein	Natural	Immunostimulant	Toll-like receptor 2 (TLR2)/Toll-like receptor (TLR1	Toll-like receptor (TLR)	Human	NA	NA	NA	NA	NA	capable of stimulating a proinflammatory response and the cellular receptors they trigger	NA	18079113	2008	NA
PRRID_0353	Unmethylated CpG DNA Click for more detail	Bacteria	NA	NA	NA	Natural	initiate intracellular signaling cascades that may lead to host inflammation.	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Human	basal epithelial layer.	Leucine-rich Repeat (LRR) Domain	Q9NR96.fasta	Q9NR96	1032	NA	immunohistochemistry	18793367	2008	Pubchem Assay
PRRID_0353	Unmethylated CpG DNA Click for more detail	Bacteria	NA	NA	NA	Natural	initiate intracellular signaling cascades that may lead to host inflammation.	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Human	basal epithelial layer.	Leucine-rich Repeat (LRR) Domain	Q9NR96.fasta	Q9NR96	1032	NA	immunohistochemistry	18793367	2008	Pubchem Assay
PRRID_0371	Lipoteichoic Acid (LTA) Click for more detail	S. aureus (Bacteria)	C(C1C(C(C(C(O1)OCC(CO)O)OC2C(C(C(C(O2)COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(CO)O)O)O)O)O)O)O)O)O)O	NA	Amphiphile	Natural	It induces the production of the pro-inflammatory cytokines such as TNF-alpha and CXCL8.	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	Odontoblasts	LRR	O60603.fasta	O60603	784	It has inflammatory/immune response agianst gram-positive bacteria.	ELISA	19250704	2009	Pubchem Assay
PRRID_0371	Lipoteichoic Acid (LTA) Click for more detail	S. aureus (Bacteria)	C(C1C(C(C(C(O1)OCC(CO)O)OC2C(C(C(C(O2)COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(CO)O)O)O)O)O)O)O)O)O)O	NA	Amphiphile	Natural	It induces the production of the pro-inflammatory cytokines such as TNF-alpha and CXCL8.	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	Odontoblasts	LRR	O60603.fasta	O60603	784	It has inflammatory/immune response agianst gram-positive bacteria.	ELISA	19250704	2009	Pubchem Assay
PRRID_0372	Lipoteichoic Acid (LTA) Click for more detail	S. aureus (Bacteria)	C(C1C(C(C(C(O1)OCC(CO)O)OC2C(C(C(C(O2)COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(CO)O)O)O)O)O)O)O)O)O)O	NA	Amphiphile	Natural	It induces the production of the pro-inflammatory cytokines such as TNF-alpha and CXCL8.	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	Dental pulp fibroblasts	LRR	O60603.fasta	O60603	784	It has inflammatory/immune response agianst gram-positive bacteria.	ELISA	19250704	2009	Pubchem Assay
PRRID_0372	Lipoteichoic Acid (LTA) Click for more detail	S. aureus (Bacteria)	C(C1C(C(C(C(O1)OCC(CO)O)OC2C(C(C(C(O2)COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(CO)O)O)O)O)O)O)O)O)O)O	NA	Amphiphile	Natural	It induces the production of the pro-inflammatory cytokines such as TNF-alpha and CXCL8.	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	Dental pulp fibroblasts	LRR	O60603.fasta	O60603	784	It has inflammatory/immune response agianst gram-positive bacteria.	ELISA	19250704	2009	Pubchem Assay
PRRID_0373	Lipoteichoic Acid (LTA) Click for more detail	S. aureus (Bacteria)	C(C1C(C(C(C(O1)OCC(CO)O)OC2C(C(C(C(O2)COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(CO)O)O)O)O)O)O)O)O)O)O	NA	Amphiphile	Natural	It induces the production of the pro-inflammatory cytokines such as TNF-alpha, IL-1beta and CXCL8.	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	Immature dendritic cells	LRR	O60603.fasta	O60603	784	It has inflammatory/immune response agianst gram-positive bacteria.	ELISA	19250704	2009	Pubchem Assay
PRRID_0373	Lipoteichoic Acid (LTA) Click for more detail	S. aureus (Bacteria)	C(C1C(C(C(C(O1)OCC(CO)O)OC2C(C(C(C(O2)COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(CO)O)O)O)O)O)O)O)O)O)O	NA	Amphiphile	Natural	It induces the production of the pro-inflammatory cytokines such as TNF-alpha, IL-1beta and CXCL8.	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	Immature dendritic cells	LRR	O60603.fasta	O60603	784	It has inflammatory/immune response agianst gram-positive bacteria.	ELISA	19250704	2009	Pubchem Assay
PRRID_0375	MALP-2 (macrophage-activating lipopeptide 2) Click for more detail	NA	C1=CC=C2C(=C1)C(=CN2)CC(C(=O)O)NC(=O)CCC(C(=O)O)N	NA	Lipopeptides	Natural	MALP-2-induced degradation of I	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	lung epithelial cells (small airway lung epithelial (SALE))	NA	O60603.fasta	O60603	784	This induces the inflammatory response.	NF-kappaB-luciferase reporter assays	19265130	2009	Pubchem Assay
PRRID_0375	MALP-2 (macrophage-activating lipopeptide 2) Click for more detail	NA	C1=CC=C2C(=C1)C(=CN2)CC(C(=O)O)NC(=O)CCC(C(=O)O)N	NA	Lipopeptides	Natural	MALP-2-induced degradation of I	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	lung epithelial cells (small airway lung epithelial (SALE))	NA	O60603.fasta	O60603	784	This induces the inflammatory response.	NF-kappaB-luciferase reporter assays	19265130	2009	Pubchem Assay
PRRID_0377	polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail	NA	C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O	NA	Nucleic Acid	Synthetic	Poly (I:C) induces the generation of IRF3-dependent type I IFN and triggers the activation of the Rho GTPase RhoA, which leads to the activation of NF-kappaB.	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	Human	lung epithelial cells (small airway lung epithelial (SALE))	NA	O15455.fasta	O15455	904	This induces the inflammatory response.	NF-kappaB-luciferase reporter assays	19265130	2009	Pubchem Assay
PRRID_0377	polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail	NA	C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O	NA	Nucleic Acid	Synthetic	Poly (I:C) induces the generation of IRF3-dependent type I IFN and triggers the activation of the Rho GTPase RhoA, which leads to the activation of NF-kappaB.	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	Human	lung epithelial cells (small airway lung epithelial (SALE))	NA	O15455.fasta	O15455	904	This induces the inflammatory response.	NF-kappaB-luciferase reporter assays	19265130	2009	Pubchem Assay

previous 1 234 5 6 7 8 9...43 44 next