Browse result page of PRRDB 2.0

PRRID	Name of Ligand	Source of ligand	Sequence of Ligand	Length of Ligand	Type of Ligand	Occurence	Role of Ligand	Name of Receptor	Type of Reeptor	Source of the Receptor	Localization	Domain	Sequence of Receptor	Swiss prot ID	Length of receptor	Function of Receptor	Assay used	PMID	Year of publication	Pubchem assay
PRRID_0750	Phosphoprotein Click for more detail	Measles virus (virus)	MAEEQARHVKNGLECIRALKAEPIGSLAIEEAMAAWSEISDNPGQERATCREEKAGSSGLSKPCLSAIGSTEGGAPRIRGQGPGESDDDAETLGIPPRNLQASSTGLQCYYVYDHSGEAVKGIQDADSIMVQSGLDGDSTLSGGDNESENSDVDIGEPDTEGYAITDRGSAPISMGFRASDVETAEGGEIHELLRLQSRGNNFPKLGKTLNVPPPPDPGRASTSGTPIKKGTERRLASFGTEIASLLTGGATQCARKSPSEPSGPGAPAGNVPEYVSNAALIQEWTPESGTTISPRSQNNEEGGDYYDDELFSDVQDIKTALAKIHEDNQKIISKLESLLLLKGEVESIKKQINRQNISISTLEGHLSSIMIAIPGLGKDPNDPTADVEINPDLKPIIGRDSGRALAEVLKKPVASRQLQGMTNGRTSSRGQLLKEFQPKPIGKKMSSAVGFVPDTGPASRSVIRSIIKSSRLEEDRKRYLMTLLDDIKGANDLAKFHQMLMKIIMK	507	Protein	Natural	Suppress NF-Œ∫B and AP-1 activation (Upregulate host NF-Œ∫B negative regulator A20)	Toll-like receptor 1/2 (TLR1/2)	Toll-like receptor (TLR)	Human	NA	Leucine-rich Repeat (LRR) Domain	NA	NA	NA	Inhibit proinflammatory cytokine and chemokine production	NA	20672047	2010	NA
PRRID_0750	Phosphoprotein Click for more detail	Measles virus (virus)	MAEEQARHVKNGLECIRALKAEPIGSLAIEEAMAAWSEISDNPGQERATCREEKAGSSGLSKPCLSAIGSTEGGAPRIRGQGPGESDDDAETLGIPPRNLQASSTGLQCYYVYDHSGEAVKGIQDADSIMVQSGLDGDSTLSGGDNESENSDVDIGEPDTEGYAITDRGSAPISMGFRASDVETAEGGEIHELLRLQSRGNNFPKLGKTLNVPPPPDPGRASTSGTPIKKGTERRLASFGTEIASLLTGGATQCARKSPSEPSGPGAPAGNVPEYVSNAALIQEWTPESGTTISPRSQNNEEGGDYYDDELFSDVQDIKTALAKIHEDNQKIISKLESLLLLKGEVESIKKQINRQNISISTLEGHLSSIMIAIPGLGKDPNDPTADVEINPDLKPIIGRDSGRALAEVLKKPVASRQLQGMTNGRTSSRGQLLKEFQPKPIGKKMSSAVGFVPDTGPASRSVIRSIIKSSRLEEDRKRYLMTLLDDIKGANDLAKFHQMLMKIIMK	507	Protein	Natural	Suppress NF-Œ∫B and AP-1 activation (Upregulate host NF-Œ∫B negative regulator A20)	Toll-like receptor 1/2 (TLR1/2)	Toll-like receptor (TLR)	Human	NA	Leucine-rich Repeat (LRR) Domain	NA	NA	NA	Inhibit proinflammatory cytokine and chemokine production	NA	20672047	2010	NA
PRRID_0751	poly U Click for more detail	NA	NA	NA	Nucleic Acid	Synthetic	It led to the activation of NF-Œ∫B and upregulate the expression of the antiapoptotic protein Bcl-2.	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Human	Lung cancer cells	NA	Q9NYK1.fasta	Q9NYK1	1049	This resulted into increased tumor cell survival and resistance to apoptosis induced by chemotherapy.	ELISA	20237413	2010	Pubchem Assay
PRRID_0751	poly U Click for more detail	NA	NA	NA	Nucleic Acid	Synthetic	It led to the activation of NF-Œ∫B and upregulate the expression of the antiapoptotic protein Bcl-2.	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Human	Lung cancer cells	NA	Q9NYK1.fasta	Q9NYK1	1049	This resulted into increased tumor cell survival and resistance to apoptosis induced by chemotherapy.	ELISA	20237413	2010	Pubchem Assay
PRRID_0753	polyadenylic-polyuridylic acid Click for more detail	Bacteria	NA	NA	Nucleic Acid	Synthetic	Their binding leads to the enhanced production of IFN-	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	Human	mDCs	Leucine-rich Repeat (LRR) Domain	O15455.fasta	O15455	904	It resulted in direct activation NK cells leading to high IFN-Œ≥ production.	NA	20639488	2010	Pubchem Assay
PRRID_0753	polyadenylic-polyuridylic acid Click for more detail	Bacteria	NA	NA	Nucleic Acid	Synthetic	Their binding leads to the enhanced production of IFN-	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	Human	mDCs	Leucine-rich Repeat (LRR) Domain	O15455.fasta	O15455	904	It resulted in direct activation NK cells leading to high IFN-Œ≥ production.	NA	20639488	2010	Pubchem Assay
PRRID_0755	polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail	NA	C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O	NA	Nucleic Acid	Synthetic	It results mTOR positively regulates interleukin 1 beta (IL-1Œ≤), tumor necrosis factor alpha (TNFŒ±) and interferon beta (IFN-Œ≤) expression, but negatively regulates IL-12p70 expression in keratinocytes	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	Human	Keratinocytes	Leucine-rich Repeat (LRR) Domain	O15455.fasta	O15455	904	It leads to the inflammatory response from the immune system leads to the clearance of pathogens	NA	20728939	2010	Pubchem Assay
PRRID_0755	polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail	NA	C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O	NA	Nucleic Acid	Synthetic	It results mTOR positively regulates interleukin 1 beta (IL-1Œ≤), tumor necrosis factor alpha (TNFŒ±) and interferon beta (IFN-Œ≤) expression, but negatively regulates IL-12p70 expression in keratinocytes	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	Human	Keratinocytes	Leucine-rich Repeat (LRR) Domain	O15455.fasta	O15455	904	It leads to the inflammatory response from the immune system leads to the clearance of pathogens	NA	20728939	2010	Pubchem Assay
PRRID_0756	polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail	NA	C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O	NA	Nucleic Acid	Synthetic	Reduced HIV-1 expression	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	Human	Macrophages	Leucine-rich Repeat (LRR) Domain	O15455.fasta	O15455	904	It leads to the clearance of the pathogen from the system	NA	20719993	2010	Pubchem Assay
PRRID_0756	polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail	NA	C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O	NA	Nucleic Acid	Synthetic	Reduced HIV-1 expression	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	Human	Macrophages	Leucine-rich Repeat (LRR) Domain	O15455.fasta	O15455	904	It leads to the clearance of the pathogen from the system	NA	20719993	2010	Pubchem Assay
PRRID_0758	polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail	NA	C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O	NA	Nucleic Acid	Synthetic	NA	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	organotypic Human brain slice cultures	Astrocytes	Leucine-rich Repeat (LRR) Domain	O15455.fasta	O15455	904	It improves the survival of neurons	NA	20706642	2010	Pubchem Assay
PRRID_0758	polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail	NA	C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O	NA	Nucleic Acid	Synthetic	NA	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	organotypic Human brain slice cultures	Astrocytes	Leucine-rich Repeat (LRR) Domain	O15455.fasta	O15455	904	It improves the survival of neurons	NA	20706642	2010	Pubchem Assay
PRRID_0760	polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail	NA	C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O	NA	Nucleic Acid	Synthetic	induced the secretion of IL-6 and IL-8	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	Human	primary corneal epithelial cells and primary conjunctival epithelial cells, endothelial cells and fibroblasts	Leucine-rich Repeat (LRR) Domain	O15455.fasta	O15455	904	It has the role in the inflammation.	NA	20703156	2010	Pubchem Assay
PRRID_0760	polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail	NA	C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O	NA	Nucleic Acid	Synthetic	induced the secretion of IL-6 and IL-8	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	Human	primary corneal epithelial cells and primary conjunctival epithelial cells, endothelial cells and fibroblasts	Leucine-rich Repeat (LRR) Domain	O15455.fasta	O15455	904	It has the role in the inflammation.	NA	20703156	2010	Pubchem Assay
PRRID_0762	polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail	NA	C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O	NA	Nucleic Acid	Synthetic	Their binding leads to the enhanced production of type I IFNs	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	Human	mDCs	Leucine-rich Repeat (LRR) Domain	O15455.fasta	O15455	904	It resulted in direct activation NK cells leading to high IFN-Œ≥ production in synergy with mDC-released soluble mediators induced by dsRNA	NA	20639488	2010	Pubchem Assay
PRRID_0762	polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail	NA	C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O	NA	Nucleic Acid	Synthetic	Their binding leads to the enhanced production of type I IFNs	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	Human	mDCs	Leucine-rich Repeat (LRR) Domain	O15455.fasta	O15455	904	It resulted in direct activation NK cells leading to high IFN-Œ≥ production in synergy with mDC-released soluble mediators induced by dsRNA	NA	20639488	2010	Pubchem Assay
PRRID_0763	polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail	NA	C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O	NA	Nucleic Acid	Synthetic	Their binding leads to the enhanced production of type I IFNs	RIG-1	Rig-like receptor (RLR)	Human	Nk cell and mDCs	NA	O95786.fasta	O95786	925	It resulted in direct activation NK cells leading to high IFN-Œ≥ production in synergy with mDC-released soluble mediators induced by dsRNA	NA	20639488	2010	Pubchem Assay
PRRID_0763	polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail	NA	C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O	NA	Nucleic Acid	Synthetic	Their binding leads to the enhanced production of type I IFNs	RIG-1	Rig-like receptor (RLR)	Human	Nk cell and mDCs	NA	O95786.fasta	O95786	925	It resulted in direct activation NK cells leading to high IFN-Œ≥ production in synergy with mDC-released soluble mediators induced by dsRNA	NA	20639488	2010	Pubchem Assay
PRRID_0764	polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail	NA	C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O	NA	Nucleic Acid	Synthetic	Their binding leads to the enhanced production of type I IFNs	RIG-1	Rig-like receptor (RLR)	Human	Nk cell and mDCs	NA	O95786.fasta	O95786	925	It resulted in direct activation NK cells leading to high IFN-Œ≥ production in synergy with mDC-released soluble mediators induced by dsRNA	NA	20639488	2010	Pubchem Assay
PRRID_0764	polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail	NA	C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O	NA	Nucleic Acid	Synthetic	Their binding leads to the enhanced production of type I IFNs	RIG-1	Rig-like receptor (RLR)	Human	Nk cell and mDCs	NA	O95786.fasta	O95786	925	It resulted in direct activation NK cells leading to high IFN-Œ≥ production in synergy with mDC-released soluble mediators induced by dsRNA	NA	20639488	2010	Pubchem Assay
PRRID_0765	polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail	NA	C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O	NA	Nucleic Acid	Synthetic	The binding of ligand to TLR3 results into induction of type I interferon inducible antiviral factors, including APOBEC3G and tetherin.	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	Human	Monocyte-derived macrophages	Leucine-rich Repeat (LRR) Domain	O15455.fasta	O15455	904	Activation of TLR-3 inhibits human immunodeficiency virus (HIV) replication and hence inhibits HIV-1 infection of macrophages	ELISA	20636339	2010	Pubchem Assay
PRRID_0765	polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail	NA	C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O	NA	Nucleic Acid	Synthetic	The binding of ligand to TLR3 results into induction of type I interferon inducible antiviral factors, including APOBEC3G and tetherin.	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	Human	Monocyte-derived macrophages	Leucine-rich Repeat (LRR) Domain	O15455.fasta	O15455	904	Activation of TLR-3 inhibits human immunodeficiency virus (HIV) replication and hence inhibits HIV-1 infection of macrophages	ELISA	20636339	2010	Pubchem Assay
PRRID_0766	polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail	NA	C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O	NA	Nucleic Acid	Synthetic	The binding results into secretion of low amounts of IL-12(p70) and high levels of IL-10 ompared with adult cells	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	Human	Cord blood cells	Leucine-rich Repeat (LRR) Domain	O15455.fasta	O15455	904	NA	NA	20636030	2010	Pubchem Assay
PRRID_0766	polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail	NA	C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O	NA	Nucleic Acid	Synthetic	The binding results into secretion of low amounts of IL-12(p70) and high levels of IL-10 ompared with adult cells	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	Human	Cord blood cells	Leucine-rich Repeat (LRR) Domain	O15455.fasta	O15455	904	NA	NA	20636030	2010	Pubchem Assay
PRRID_0769	polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail	NA	C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O	NA	Nucleic Acid	Synthetic	It's binding induces the production of IL6, IL8, MMP3 and MMP3	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	Human	Fibroblast Like Synoviocytes (FLS)	Leucine-rich Repeat (LRR) Domain	O15455.fasta	O15455	904	It has a role in the pathogenesis of juvenile idiopathic arthritis and cartilage destruction	ELISA	20571165	2010	Pubchem Assay
PRRID_0769	polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail	NA	C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O	NA	Nucleic Acid	Synthetic	It's binding induces the production of IL6, IL8, MMP3 and MMP3	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	Human	Fibroblast Like Synoviocytes (FLS)	Leucine-rich Repeat (LRR) Domain	O15455.fasta	O15455	904	It has a role in the pathogenesis of juvenile idiopathic arthritis and cartilage destruction	ELISA	20571165	2010	Pubchem Assay
PRRID_0770	polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail	NA	C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O	NA	Nucleic Acid	Synthetic	Poly[I:C] stimulate the activaion of natural killer cells which leads to the secretion of IL-6 ,TNF-‚ç∫ and IFN-	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	Human	Natural Killer cells from peripheral blood	Leucine-rich Repeat (LRR) Domain	O15455.fasta	O15455	904	It has a immunostimulatory role	Flex-Set cytokine assay	20427039	2010	Pubchem Assay
PRRID_0770	polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail	NA	C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O	NA	Nucleic Acid	Synthetic	Poly[I:C] stimulate the activaion of natural killer cells which leads to the secretion of IL-6 ,TNF-‚ç∫ and IFN-	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	Human	Natural Killer cells from peripheral blood	Leucine-rich Repeat (LRR) Domain	O15455.fasta	O15455	904	It has a immunostimulatory role	Flex-Set cytokine assay	20427039	2010	Pubchem Assay
PRRID_0771	polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail	NA	C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O	NA	Nucleic Acid	Synthetic	Poly[I:C] stimulate the activaion of natural killer cells which leads to the secretion of IL-6 ,TNF-‚ç∫ and IFN-	MDA5	Rig-like receptor (RLR)	Human	Natural Killer cells from peripheral blood	NA	Q53TB6.fasta	Q53TB6	435	It has a immunostimulatory role	Flex-Set cytokine assay	20427039	2010	Pubchem Assay
PRRID_0771	polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail	NA	C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O	NA	Nucleic Acid	Synthetic	Poly[I:C] stimulate the activaion of natural killer cells which leads to the secretion of IL-6 ,TNF-‚ç∫ and IFN-	MDA5	Rig-like receptor (RLR)	Human	Natural Killer cells from peripheral blood	NA	Q53TB6.fasta	Q53TB6	435	It has a immunostimulatory role	Flex-Set cytokine assay	20427039	2010	Pubchem Assay
PRRID_0778	profilin-like protein Click for more detail	T. gondii (others)	MSDWDPVVKEWLVDTGYCCAGGIANAEDGVVFAAAADDDDGWSKLYKDDHEEDTIGEDGNACGKVSINEASTIKAAVDDGSAPNGVWIGGQKYKVVRPEKGFEYNDCTFDITMCARSKGGAHLIKTPNGSIVIALYDEEKEQDKGNSRTSALAFAEYLHQSGY	163	Protein	Natural	Upon recogniton by the TLR, it induces induces the recruitment of adaptor proteins MyD95	MDA5	Rig-like receptor (RLR)	Human	Cell surface	Leucine-rich Repeat (LRR) Domain	Q53TB6.fasta	Q53TB6	435	It leadsto the secretion of the proinfalmmatory and IFN-‚ç∫	NA	20620129	2010	Pubchem Assay
PRRID_0778	profilin-like protein Click for more detail	T. gondii (others)	MSDWDPVVKEWLVDTGYCCAGGIANAEDGVVFAAAADDDDGWSKLYKDDHEEDTIGEDGNACGKVSINEASTIKAAVDDGSAPNGVWIGGQKYKVVRPEKGFEYNDCTFDITMCARSKGGAHLIKTPNGSIVIALYDEEKEQDKGNSRTSALAFAEYLHQSGY	163	Protein	Natural	Upon recogniton by the TLR, it induces induces the recruitment of adaptor proteins MyD95	MDA5	Rig-like receptor (RLR)	Human	Cell surface	Leucine-rich Repeat (LRR) Domain	Q53TB6.fasta	Q53TB6	435	It leadsto the secretion of the proinfalmmatory and IFN-‚ç∫	NA	20620129	2010	Pubchem Assay
PRRID_0781	R-Lipopolysaccharide (LPS) Click for more detail	Salmonella minnesota (Bacteria)	CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC	NA	Lipopolysaccharide (LPS)	Natural	Activate monocytes and neutrophils with differential CD14 expression.	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	Monocytes and Neutrophils	Leucine-rich Repeat (LRR) Domain	O00206.fasta	O00206	839	It leads to the inflammatory response from the immune system leads to the clearance of pathogens	NA	20721471	2010	Pubchem Assay
PRRID_0781	R-Lipopolysaccharide (LPS) Click for more detail	Salmonella minnesota (Bacteria)	CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC	NA	Lipopolysaccharide (LPS)	Natural	Activate monocytes and neutrophils with differential CD14 expression.	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	Monocytes and Neutrophils	Leucine-rich Repeat (LRR) Domain	O00206.fasta	O00206	839	It leads to the inflammatory response from the immune system leads to the clearance of pathogens	NA	20721471	2010	Pubchem Assay
PRRID_0782	Resiquimod (R-848) Click for more detail	imidazoquinoline (others)	CCOCC1=NC2=C(N1CC(C)(C)O)C3=CC=CC=C3N=C2N	NA	Nucleic Acid	Synthetic	The binding results into the robust TNF-‚ç∫ and IL-12 production	Toll-like receptor 7/8 (TLR7/8)	Toll-like receptor (TLR)	Human	APCs	Leucine-rich Repeat (LRR) Domain	NA	NA	NA	NA	NA	20636030	2010	NA
PRRID_0782	Resiquimod (R-848) Click for more detail	imidazoquinoline (others)	CCOCC1=NC2=C(N1CC(C)(C)O)C3=CC=CC=C3N=C2N	NA	Nucleic Acid	Synthetic	The binding results into the robust TNF-‚ç∫ and IL-12 production	Toll-like receptor 7/8 (TLR7/8)	Toll-like receptor (TLR)	Human	APCs	Leucine-rich Repeat (LRR) Domain	NA	NA	NA	NA	NA	20636030	2010	NA
PRRID_0783	RID Click for more detail	Adenovirus(virus)	MVTPLLLLVCLPIIYASTTFAAVSHLDTDCLPALLTYLIFTSVCCTAICSIATFFVAIFQTADYLYVRVAYYRHHPQYRNHEVATLLCLS	90	Protein	Natural	Suppress NF-Œ∫B and AP-1 activation	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	NA	Leucine-rich Repeat (LRR) Domain	O00206.fasta	O00206	839	Suppress MCP-1 and IL-8 production	NA	20672047	2010	Pubchem Assay
PRRID_0783	RID Click for more detail	Adenovirus(virus)	MVTPLLLLVCLPIIYASTTFAAVSHLDTDCLPALLTYLIFTSVCCTAICSIATFFVAIFQTADYLYVRVAYYRHHPQYRNHEVATLLCLS	90	Protein	Natural	Suppress NF-Œ∫B and AP-1 activation	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	NA	Leucine-rich Repeat (LRR) Domain	O00206.fasta	O00206	839	Suppress MCP-1 and IL-8 production	NA	20672047	2010	Pubchem Assay
PRRID_0785	RNA40 Click for more detail	HIV-1 (virus)	NA	NA	Nucleic Acid	Natural	Activate IRF-7 mediated by MyD88	Toll-like receptor 1/2 (TLR1/2)	Toll-like receptor (TLR)	Human	NA	Leucine-rich Repeat (LRR) Domain	NA	NA	NA	Activate pDCs	NA	20672047	2010	NA
PRRID_0785	RNA40 Click for more detail	HIV-1 (virus)	NA	NA	Nucleic Acid	Natural	Activate IRF-7 mediated by MyD88	Toll-like receptor 1/2 (TLR1/2)	Toll-like receptor (TLR)	Human	NA	Leucine-rich Repeat (LRR) Domain	NA	NA	NA	Activate pDCs	NA	20672047	2010	NA
PRRID_0787	S-Lipopolysaccharide (LPS) Click for more detail	Salmonella abortus equi (Bacteria)	CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC	NA	Lipopolysaccharide (LPS)	Natural	Activate monocytes and neutrophils with differential CD14 expression.	Toll-like receptor 5 (TLR5)	Toll-like receptor (TLR)	Human	Monocytes and Neutrophils	Leucine-rich Repeat (LRR) Domain	O60602.fasta	O60602	858	It leads to the inflammatory response from the immune system leads to the clearance of pathogens	NA	20721471	2010	Pubchem Assay
PRRID_0787	S-Lipopolysaccharide (LPS) Click for more detail	Salmonella abortus equi (Bacteria)	CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC	NA	Lipopolysaccharide (LPS)	Natural	Activate monocytes and neutrophils with differential CD14 expression.	Toll-like receptor 5 (TLR5)	Toll-like receptor (TLR)	Human	Monocytes and Neutrophils	Leucine-rich Repeat (LRR) Domain	O60602.fasta	O60602	858	It leads to the inflammatory response from the immune system leads to the clearance of pathogens	NA	20721471	2010	Pubchem Assay
PRRID_0788	SE-derived secreted factor (SE-S) Click for more detail	Staphylococcus epidermidis strain 1457 (Bacteria)	MNYSKITVTLIIILLCTFSFEFSFNRFVQADESRPKIESLKKKSELDSTALYNIKTSYSQDNIILDIKNKTNSTQLLSNDLIFDDITLKEWNKNSLKTEFNSSEIANHFKGKKVDIFGIYYGANCIGEVSKRTGCIYGGITLHEEEKIDQKNSIGVNVFKDGSQQKGFMITTDKKEPTIQELDLKTRKVIQNQYKIYNSETGNIQKGYMEFHSNSSSFYYDLFNFKGKYSVDFLKFYNDNKTINSSNLHIDVYLYSQ	257	Soluble factor	Natural	TLR2 mediated SE-induced cytokine production such as TNF, CXCL1 and CXCL2	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	human embryonic kidney cells, human whole blood and murine primary macrophages	Leucine-rich Repeat (LRR) Domain	O60603.fasta	O60603	784	TLR2 mediates recognition of live SE and clearance of SE bacteremia.	Cytokines assay	20404927	2010	Pubchem Assay
PRRID_0788	SE-derived secreted factor (SE-S) Click for more detail	Staphylococcus epidermidis strain 1457 (Bacteria)	MNYSKITVTLIIILLCTFSFEFSFNRFVQADESRPKIESLKKKSELDSTALYNIKTSYSQDNIILDIKNKTNSTQLLSNDLIFDDITLKEWNKNSLKTEFNSSEIANHFKGKKVDIFGIYYGANCIGEVSKRTGCIYGGITLHEEEKIDQKNSIGVNVFKDGSQQKGFMITTDKKEPTIQELDLKTRKVIQNQYKIYNSETGNIQKGYMEFHSNSSSFYYDLFNFKGKYSVDFLKFYNDNKTINSSNLHIDVYLYSQ	257	Soluble factor	Natural	TLR2 mediated SE-induced cytokine production such as TNF, CXCL1 and CXCL2	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	human embryonic kidney cells, human whole blood and murine primary macrophages	Leucine-rich Repeat (LRR) Domain	O60603.fasta	O60603	784	TLR2 mediates recognition of live SE and clearance of SE bacteremia.	Cytokines assay	20404927	2010	Pubchem Assay
PRRID_0790	single-stranded RNA Click for more detail	Virus	NA	NA	Nucleic Acid	Natural	Activates NF-KB and MAPK which lead to the production of cytokines as TNF and other proinflammatory proteins	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Human	NA	Leucine-rich Repeat (LRR) Domain	Q9NYK1.fasta	Q9NYK1	1049	It coauses the inflammation	NA	20740341	2010	Pubchem Assay
PRRID_0790	single-stranded RNA Click for more detail	Virus	NA	NA	Nucleic Acid	Natural	Activates NF-KB and MAPK which lead to the production of cytokines as TNF and other proinflammatory proteins	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Human	NA	Leucine-rich Repeat (LRR) Domain	Q9NYK1.fasta	Q9NYK1	1049	It coauses the inflammation	NA	20740341	2010	Pubchem Assay
PRRID_0791	single-stranded RNA Click for more detail	Virus	NA	NA	Nucleic Acid	Natural	Activates NF-KB and MAPK which lead to the production of cytokines as TNF and other proinflammatory proteins	Toll-like receptor 8 (TLR8)	Toll-like receptor (TLR)	Human	NA	Leucine-rich Repeat (LRR) Domain	Q9NR97.fasta	Q9NR97	1041	It coauses the inflammation	NA	20740341	2010	Pubchem Assay
PRRID_0791	single-stranded RNA Click for more detail	Virus	NA	NA	Nucleic Acid	Natural	Activates NF-KB and MAPK which lead to the production of cytokines as TNF and other proinflammatory proteins	Toll-like receptor 8 (TLR8)	Toll-like receptor (TLR)	Human	NA	Leucine-rich Repeat (LRR) Domain	Q9NR97.fasta	Q9NR97	1041	It coauses the inflammation	NA	20740341	2010	Pubchem Assay
PRRID_0793	single-stranded RNA Click for more detail	Virus	NA	NA	Nucleic Acid	Natural	lipid mediators of inflammation	Toll-like receptor 8 (TLR8)	Toll-like receptor (TLR)	Human(Ovarian Cancer Patient)	NA	Leucine-rich Repeat (LRR) Domain	Q9NR97.fasta	Q9NR97	1041	It leads to the inflammatory response from the immune system leads to the clearance of pathogens	NA	20728343	2010	Pubchem Assay
PRRID_0793	single-stranded RNA Click for more detail	Virus	NA	NA	Nucleic Acid	Natural	lipid mediators of inflammation	Toll-like receptor 8 (TLR8)	Toll-like receptor (TLR)	Human(Ovarian Cancer Patient)	NA	Leucine-rich Repeat (LRR) Domain	Q9NR97.fasta	Q9NR97	1041	It leads to the inflammatory response from the immune system leads to the clearance of pathogens	NA	20728343	2010	Pubchem Assay
PRRID_0794	single-stranded RNA Click for more detail	HIV-1 (virus)	NA	NA	Nucleic Acid	Natural	It suppresses virus replication	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Human	plasmacytoid DCs	Leucine-rich Repeat (LRR) Domain	Q9NYK1.fasta	Q9NYK1	1049	It leads to the clearance of the pathogen from the system	NA	20719993	2010	Pubchem Assay
PRRID_0794	single-stranded RNA Click for more detail	HIV-1 (virus)	NA	NA	Nucleic Acid	Natural	It suppresses virus replication	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Human	plasmacytoid DCs	Leucine-rich Repeat (LRR) Domain	Q9NYK1.fasta	Q9NYK1	1049	It leads to the clearance of the pathogen from the system	NA	20719993	2010	Pubchem Assay
PRRID_0795	single-stranded RNA Click for more detail	HIV-1 (virus)	NA	NA	Nucleic Acid	Natural	It suppresses virus replication	Toll-like receptor 8 (TLR8)	Toll-like receptor (TLR)	Human	plasmacytoid DCs	Leucine-rich Repeat (LRR) Domain	Q9NR97.fasta	Q9NR97	1041	It leads to the clearance of the pathogen from the system	NA	20719993	2010	Pubchem Assay
PRRID_0795	single-stranded RNA Click for more detail	HIV-1 (virus)	NA	NA	Nucleic Acid	Natural	It suppresses virus replication	Toll-like receptor 8 (TLR8)	Toll-like receptor (TLR)	Human	plasmacytoid DCs	Leucine-rich Repeat (LRR) Domain	Q9NR97.fasta	Q9NR97	1041	It leads to the clearance of the pathogen from the system	NA	20719993	2010	Pubchem Assay
PRRID_0796	single-stranded RNA Click for more detail	Virus	NA	NA	Nucleic Acid	Natural	It produce pro-inflammatory cytokines including IFNŒ±, TNFŒ± and/or IL-12	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Human	DCs, monocytes, macrophages, lymphocytes, Langerhans cells, and NK cells	Leucine-rich Repeat (LRR) Domain	Q9NYK1.fasta	Q9NYK1	1049	Itresults into the inflammatory response	NA	20713100	2010	Pubchem Assay
PRRID_0796	single-stranded RNA Click for more detail	Virus	NA	NA	Nucleic Acid	Natural	It produce pro-inflammatory cytokines including IFNŒ±, TNFŒ± and/or IL-12	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Human	DCs, monocytes, macrophages, lymphocytes, Langerhans cells, and NK cells	Leucine-rich Repeat (LRR) Domain	Q9NYK1.fasta	Q9NYK1	1049	Itresults into the inflammatory response	NA	20713100	2010	Pubchem Assay
PRRID_0797	single-stranded RNA Click for more detail	Virus	NA	NA	Nucleic Acid	Natural	It produce pro-inflammatory cytokines including IFNŒ±, TNFŒ± and/or IL-12	Toll-like receptor 8 (TLR8)	Toll-like receptor (TLR)	Human	DCs, monocytes, macrophages, lymphocytes, Langerhans cells, and NK cells	Leucine-rich Repeat (LRR) Domain	Q9NR97.fasta	Q9NR97	1041	Itresults into the inflammatory response	NA	20713100	2010	Pubchem Assay
PRRID_0797	single-stranded RNA Click for more detail	Virus	NA	NA	Nucleic Acid	Natural	It produce pro-inflammatory cytokines including IFNŒ±, TNFŒ± and/or IL-12	Toll-like receptor 8 (TLR8)	Toll-like receptor (TLR)	Human	DCs, monocytes, macrophages, lymphocytes, Langerhans cells, and NK cells	Leucine-rich Repeat (LRR) Domain	Q9NR97.fasta	Q9NR97	1041	Itresults into the inflammatory response	NA	20713100	2010	Pubchem Assay
PRRID_0798	single-stranded RNA Click for more detail	West Nile Virus	NA	NA	Nucleic Acid	Natural	Upon recogniton by the TLR, it induces induces the recruitment of adaptor proteins TRIF	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	Human	Endosomes	Leucine-rich Repeat (LRR) Domain	O15455.fasta	O15455	904	it lead to the secretion of IFN-Œ≤	NA	20620129	2010	Pubchem Assay
PRRID_0798	single-stranded RNA Click for more detail	West Nile Virus	NA	NA	Nucleic Acid	Natural	Upon recogniton by the TLR, it induces induces the recruitment of adaptor proteins TRIF	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	Human	Endosomes	Leucine-rich Repeat (LRR) Domain	O15455.fasta	O15455	904	it lead to the secretion of IFN-Œ≤	NA	20620129	2010	Pubchem Assay
PRRID_0799	single-stranded RNA Click for more detail	VSV, Influenza virus	NA	NA	Nucleic Acid	Natural	Upon recogniton by the TLR, it induces induces the recruitment of adaptor proteins MyD89	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Human	Endosomes	Leucine-rich Repeat (LRR) Domain	Q9NYK1.fasta	Q9NYK1	1049	It leadsto the secretion of the proinfalmmatory and IFN-‚ç∫	NA	20620129	2010	Pubchem Assay
PRRID_0799	single-stranded RNA Click for more detail	VSV, Influenza virus	NA	NA	Nucleic Acid	Natural	Upon recogniton by the TLR, it induces induces the recruitment of adaptor proteins MyD89	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Human	Endosomes	Leucine-rich Repeat (LRR) Domain	Q9NYK1.fasta	Q9NYK1	1049	It leadsto the secretion of the proinfalmmatory and IFN-‚ç∫	NA	20620129	2010	Pubchem Assay
PRRID_0800	single-stranded RNA Click for more detail	RNA virus (Virus)	NA	NA	Nucleic Acid	Natural	Upon recogniton by the TLR, it induces induces the recruitment of adaptor proteins MyD90	Toll-like receptor 8 (TLR8)	Toll-like receptor (TLR)	Human	Endosomes	Leucine-rich Repeat (LRR) Domain	Q9NR97.fasta	Q9NR97	1041	It leadsto the secretion of the proinfalmmatory and IFN-‚ç∫	NA	20620129	2010	Pubchem Assay
PRRID_0800	single-stranded RNA Click for more detail	RNA virus (Virus)	NA	NA	Nucleic Acid	Natural	Upon recogniton by the TLR, it induces induces the recruitment of adaptor proteins MyD90	Toll-like receptor 8 (TLR8)	Toll-like receptor (TLR)	Human	Endosomes	Leucine-rich Repeat (LRR) Domain	Q9NR97.fasta	Q9NR97	1041	It leadsto the secretion of the proinfalmmatory and IFN-‚ç∫	NA	20620129	2010	Pubchem Assay
PRRID_0801	siSC2 dsRNA Click for more detail	NA	NA	NA	Nucleic Acid	Synthetic	Induce type 1 IFN production	Toll-like receptor 3 (TLR3)/Toll-like receptor 8 (TLR8)	Toll-like receptor (TLR)	Human	PBMCs	Leucine-rich Repeat (LRR) Domain	NA	NA	NA	Immunostimulation	NA	20692289	2010	NA
PRRID_0801	siSC2 dsRNA Click for more detail	NA	NA	NA	Nucleic Acid	Synthetic	Induce type 1 IFN production	Toll-like receptor 3 (TLR3)/Toll-like receptor 8 (TLR8)	Toll-like receptor (TLR)	Human	PBMCs	Leucine-rich Repeat (LRR) Domain	NA	NA	NA	Immunostimulation	NA	20692289	2010	NA
PRRID_0802	SitC-His Click for more detail	S. aureus (Bacteria)	NA	NA	Lipoprotein	Natural	Induce IL-6 and TNF-‚ç∫ release	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	Monocytes	Leucine-rich Repeat (LRR) Domain	O60603.fasta	O60603	784	NA	NA	20679445	2010	Pubchem Assay
PRRID_0802	SitC-His Click for more detail	S. aureus (Bacteria)	NA	NA	Lipoprotein	Natural	Induce IL-6 and TNF-‚ç∫ release	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	Monocytes	Leucine-rich Repeat (LRR) Domain	O60603.fasta	O60603	784	NA	NA	20679445	2010	Pubchem Assay
PRRID_0803	SitC-His Click for more detail	S. aureus (Bacteria)	NA	NA	Lipoprotein	Natural	Activation of NF-	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	HEK293	Leucine-rich Repeat (LRR) Domain	O60603.fasta	O60603	784	NA	NA	20679445	2010	Pubchem Assay
PRRID_0803	SitC-His Click for more detail	S. aureus (Bacteria)	NA	NA	Lipoprotein	Natural	Activation of NF-	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	HEK293	Leucine-rich Repeat (LRR) Domain	O60603.fasta	O60603	784	NA	NA	20679445	2010	Pubchem Assay
PRRID_0810	Stathmins Click for more detail	Human (others)	MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESKDPADETEAD	149	Endogenous	Natural	Binding of stathmins to TLR3 activates downstream signalling pathways via TRIF and lead to the secretion of IL-6 and CXCL-8	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	Human	Astrocytes and microglia	Leucine-rich Repeat (LRR) Domain	O15455.fasta	O15455	904	It has a role in astrocyte-mediated neuroprotection and in morphogenesis in the CNS	NA	20483774	2010	Pubchem Assay
PRRID_0810	Stathmins Click for more detail	Human (others)	MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESKDPADETEAD	149	Endogenous	Natural	Binding of stathmins to TLR3 activates downstream signalling pathways via TRIF and lead to the secretion of IL-6 and CXCL-8	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	Human	Astrocytes and microglia	Leucine-rich Repeat (LRR) Domain	O15455.fasta	O15455	904	It has a role in astrocyte-mediated neuroprotection and in morphogenesis in the CNS	NA	20483774	2010	Pubchem Assay
PRRID_0816	Tat Click for more detail	HIV-1 (virus)	MEPVDPRLEPWKHPGSQPKTACTNCYCKKCCFHCQVCFITKALGISYGRKKRRQRRRAHQNSQTHQASLSKQPTSQPRGDPTGPKE	86	Protein	Natural	Activate NF-Œ∫B (PKR-dependent)	Toll-like receptor 1/2 (TLR1/2)	Toll-like receptor (TLR)	Human	NA	Leucine-rich Repeat (LRR) Domain	NA	NA	NA	NA	NA	20672047	2010	NA
PRRID_0816	Tat Click for more detail	HIV-1 (virus)	MEPVDPRLEPWKHPGSQPKTACTNCYCKKCCFHCQVCFITKALGISYGRKKRRQRRRAHQNSQTHQASLSKQPTSQPRGDPTGPKE	86	Protein	Natural	Activate NF-Œ∫B (PKR-dependent)	Toll-like receptor 1/2 (TLR1/2)	Toll-like receptor (TLR)	Human	NA	Leucine-rich Repeat (LRR) Domain	NA	NA	NA	NA	NA	20672047	2010	NA
PRRID_0818	Triacylated lipopeptides Click for more detail	Bacteria	NA	NA	Lipopeptides	Natural	Activates NF-KB and MAPK which lead to the production of cytokines as TNF and other proinflammatory proteins	Toll-like receptor 2 (TLR2)-Toll-like receptor (TLR1 dimer)	Toll-like receptor (TLR)	Human	NA	Leucine-rich Repeat (LRR) Domain	NA	NA	NA	It coauses the inflammation	NA	20740341	2010	NA
PRRID_0818	Triacylated lipopeptides Click for more detail	Bacteria	NA	NA	Lipopeptides	Natural	Activates NF-KB and MAPK which lead to the production of cytokines as TNF and other proinflammatory proteins	Toll-like receptor 2 (TLR2)-Toll-like receptor (TLR1 dimer)	Toll-like receptor (TLR)	Human	NA	Leucine-rich Repeat (LRR) Domain	NA	NA	NA	It coauses the inflammation	NA	20740341	2010	NA
PRRID_0819	Triacylated lipopeptides Click for more detail	Bacteria and Mycobacteria	NA	NA	Lipopeptides	Natural	Upon recogniton by the TLR, it induces induces the recruitment of adaptor proteins MyD88,/TIRAP and aloow the rerutiment of downstream effector	Toll-like receptor 1/2 (TLR1/2)	Toll-like receptor (TLR)	Human	Cell surface	Leucine-rich Repeat (LRR) Domain	NA	NA	NA	It leadsto the secretion of the proinfalmmatory cytokines	NA	20620129	2010	NA
PRRID_0819	Triacylated lipopeptides Click for more detail	Bacteria and Mycobacteria	NA	NA	Lipopeptides	Natural	Upon recogniton by the TLR, it induces induces the recruitment of adaptor proteins MyD88,/TIRAP and aloow the rerutiment of downstream effector	Toll-like receptor 1/2 (TLR1/2)	Toll-like receptor (TLR)	Human	Cell surface	Leucine-rich Repeat (LRR) Domain	NA	NA	NA	It leadsto the secretion of the proinfalmmatory cytokines	NA	20620129	2010	NA
PRRID_0825	Unmethylated CpG DNA Click for more detail	Bacteria	NA	NA	Nucleic Acid	Natural	It leads to the maturation, differentiation, and/or proliferation of NK cells, T cells, B cells, monocytes and macrophages and production of pro-inflammatory and Th-1 biased cytokines	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Human	B cells and pDC	NA	Q9NR96.fasta	Q9NR96	1032	It has the role in the inflammation.	NA	20713100	2010	Pubchem Assay
PRRID_0825	Unmethylated CpG DNA Click for more detail	Bacteria	NA	NA	Nucleic Acid	Natural	It leads to the maturation, differentiation, and/or proliferation of NK cells, T cells, B cells, monocytes and macrophages and production of pro-inflammatory and Th-1 biased cytokines	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Human	B cells and pDC	NA	Q9NR96.fasta	Q9NR96	1032	It has the role in the inflammation.	NA	20713100	2010	Pubchem Assay
PRRID_0826	Unmethylated CpG DNA Click for more detail	Bacteria	NA	NA	Nucleic Acid	Natural	It leads to the activation of the TLR9 and results into the secretion of the cytokines	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Human	NA	Leucine-rich Repeat (LRR) Domain	Q9NR96.fasta	Q9NR96	1032	It has the role in the inflammation.	NA	20706677	2010	Pubchem Assay
PRRID_0826	Unmethylated CpG DNA Click for more detail	Bacteria	NA	NA	Nucleic Acid	Natural	It leads to the activation of the TLR9 and results into the secretion of the cytokines	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Human	NA	Leucine-rich Repeat (LRR) Domain	Q9NR96.fasta	Q9NR96	1032	It has the role in the inflammation.	NA	20706677	2010	Pubchem Assay
PRRID_0827	Unmethylated CpG DNA Click for more detail	Bacteria	NA	NA	Nucleic Acid	Synthetic	It's binding does not induces the production of IL6, IL8, MMP3 and MMP4	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Human	Fibroblast Like Synoviocytes (FLS)	Leucine-rich Repeat (LRR) Domain	Q9NR96.fasta	Q9NR96	1032	It has a role in the pathogenesis of juvenile idiopathic arthritis and cartilage destruction	ELISA	20571165	2010	Pubchem Assay
PRRID_0827	Unmethylated CpG DNA Click for more detail	Bacteria	NA	NA	Nucleic Acid	Synthetic	It's binding does not induces the production of IL6, IL8, MMP3 and MMP4	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Human	Fibroblast Like Synoviocytes (FLS)	Leucine-rich Repeat (LRR) Domain	Q9NR96.fasta	Q9NR96	1032	It has a role in the pathogenesis of juvenile idiopathic arthritis and cartilage destruction	ELISA	20571165	2010	Pubchem Assay
PRRID_0830	Uropathogenic E. coli Click for more detail	Bacteria	NA	NA	NA	Natural	Upon recogniton by the TLR, it induces induces the recruitment of adaptor proteins MyD94	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Human	Cell surface	Leucine-rich Repeat (LRR) Domain	Q9NR96.fasta	Q9NR96	1032	It leadsto the secretion of the proinfalmmatory and IFN-‚ç∫	NA	20620129	2010	Pubchem Assay
PRRID_0830	Uropathogenic E. coli Click for more detail	Bacteria	NA	NA	NA	Natural	Upon recogniton by the TLR, it induces induces the recruitment of adaptor proteins MyD94	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Human	Cell surface	Leucine-rich Repeat (LRR) Domain	Q9NR96.fasta	Q9NR96	1032	It leadsto the secretion of the proinfalmmatory and IFN-‚ç∫	NA	20620129	2010	Pubchem Assay
PRRID_0831	Viral DNA Click for more detail	herpes simplex virus (virus)	NA	NA	Nucleic Acid	Natural	NA	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Human	NA	Leucine-rich Repeat (LRR) Domain	Q9NR96.fasta	Q9NR96	1032	Induce IFN production	NA	20672047	2010	Pubchem Assay
PRRID_0831	Viral DNA Click for more detail	herpes simplex virus (virus)	NA	NA	Nucleic Acid	Natural	NA	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Human	NA	Leucine-rich Repeat (LRR) Domain	Q9NR96.fasta	Q9NR96	1032	Induce IFN production	NA	20672047	2010	Pubchem Assay
PRRID_0836	virions Click for more detail	EBV(virus)	MAKLETVTLGNIGKDGKQTLVLNPRGVNPTNGVASLSQAGAVPALEKRVTVSVSQPSRNRKNYKVQVKIQNPTACTANGSCDPSVTRQAYADVTFSFTQYSTDEERAFVRTELAALLASPLLIDAIDQLNPAY	NA	Virus	Natural	Release of monocyte chemoattractant protein-1 (MCP-1) and to an increase of several cytokine mRNA levels.	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	Monocytes	Leucine-rich Repeat (LRR) Domain	O60603.fasta	O60603	784	It provides antiviral immunity.	NA	20713890	2010	Pubchem Assay
PRRID_0836	virions Click for more detail	EBV(virus)	MAKLETVTLGNIGKDGKQTLVLNPRGVNPTNGVASLSQAGAVPALEKRVTVSVSQPSRNRKNYKVQVKIQNPTACTANGSCDPSVTRQAYADVTFSFTQYSTDEERAFVRTELAALLASPLLIDAIDQLNPAY	NA	Virus	Natural	Release of monocyte chemoattractant protein-1 (MCP-1) and to an increase of several cytokine mRNA levels.	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	Monocytes	Leucine-rich Repeat (LRR) Domain	O60603.fasta	O60603	784	It provides antiviral immunity.	NA	20713890	2010	Pubchem Assay
PRRID_0837	virions Click for more detail	herpes simplex virus (virus)	MAKLETVTLGNIGKDGKQTLVLNPRGVNPTNGVASLSQAGAVPALEKRVTVSVSQPSRNRKNYKVQVKIQNPTACTANGSCDPSVTRQAYADVTFSFTQYSTDEERAFVRTELAALLASPLLIDAIDQLNPAY	NA	Virus	Natural	NA	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	NA	Leucine-rich Repeat (LRR) Domain	O60603.fasta	O60603	784	Induce cytokine production	NA	20672047	2010	Pubchem Assay
PRRID_0837	virions Click for more detail	herpes simplex virus (virus)	MAKLETVTLGNIGKDGKQTLVLNPRGVNPTNGVASLSQAGAVPALEKRVTVSVSQPSRNRKNYKVQVKIQNPTACTANGSCDPSVTRQAYADVTFSFTQYSTDEERAFVRTELAALLASPLLIDAIDQLNPAY	NA	Virus	Natural	NA	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	NA	Leucine-rich Repeat (LRR) Domain	O60603.fasta	O60603	784	Induce cytokine production	NA	20672047	2010	Pubchem Assay
PRRID_0838	virions Click for more detail	Varicella-zoster (virus)	MAKLETVTLGNIGKDGKQTLVLNPRGVNPTNGVASLSQAGAVPALEKRVTVSVSQPSRNRKNYKVQVKIQNPTACTANGSCDPSVTRQAYADVTFSFTQYSTDEERAFVRTELAALLASPLLIDAIDQLNPAY	NA	Virus	Natural	NA	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	NA	Leucine-rich Repeat (LRR) Domain	O60603.fasta	O60603	784	Induce cytokine production	NA	20672047	2010	Pubchem Assay
PRRID_0838	virions Click for more detail	Varicella-zoster (virus)	MAKLETVTLGNIGKDGKQTLVLNPRGVNPTNGVASLSQAGAVPALEKRVTVSVSQPSRNRKNYKVQVKIQNPTACTANGSCDPSVTRQAYADVTFSFTQYSTDEERAFVRTELAALLASPLLIDAIDQLNPAY	NA	Virus	Natural	NA	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	NA	Leucine-rich Repeat (LRR) Domain	O60603.fasta	O60603	784	Induce cytokine production	NA	20672047	2010	Pubchem Assay
PRRID_0842	Vpr Click for more detail	HIV-1 (virus)	MEQAPEDQGPQREPHNEWTLELLEELKNEAVRHFPRIWLHGLGQHIYETYGDTWAGVEAIIRILQQLLFIHFRIGCRHSRIGVTQQRRARNGASRS	96	Protein	Natural	Activate NF-Œ∫B	Toll-like receptor 1/2 (TLR1/2)	Toll-like receptor (TLR)	Human	NA	Leucine-rich Repeat (LRR) Domain	NA	NA	NA	Enhance IL-6, IL-8, and IL-10 production	NA	20672047	2010	NA
PRRID_0842	Vpr Click for more detail	HIV-1 (virus)	MEQAPEDQGPQREPHNEWTLELLEELKNEAVRHFPRIWLHGLGQHIYETYGDTWAGVEAIIRILQQLLFIHFRIGCRHSRIGVTQQRRARNGASRS	96	Protein	Natural	Activate NF-Œ∫B	Toll-like receptor 1/2 (TLR1/2)	Toll-like receptor (TLR)	Human	NA	Leucine-rich Repeat (LRR) Domain	NA	NA	NA	Enhance IL-6, IL-8, and IL-10 production	NA	20672047	2010	NA
PRRID_0843	Vpu Click for more detail	HIV-1 (virus)	MQPIQIAIAALVVAIIIAIVVWSIVIIEYRKILRQRKIDRLIDRLIERAEDSGNESEGEISALVEMGVEMGHHAPWDIDDL	81	Protein	Natural	Inhibit NF-Œ∫B activation (Stabilize IŒ∫B)	Toll-like receptor 1/2 (TLR1/2)	Toll-like receptor (TLR)	Human	NA	Leucine-rich Repeat (LRR) Domain	NA	NA	NA	Suppress cytokine production	NA	20672047	2010	NA
PRRID_0843	Vpu Click for more detail	HIV-1 (virus)	MQPIQIAIAALVVAIIIAIVVWSIVIIEYRKILRQRKIDRLIDRLIERAEDSGNESEGEISALVEMGVEMGHHAPWDIDDL	81	Protein	Natural	Inhibit NF-Œ∫B activation (Stabilize IŒ∫B)	Toll-like receptor 1/2 (TLR1/2)	Toll-like receptor (TLR)	Human	NA	Leucine-rich Repeat (LRR) Domain	NA	NA	NA	Suppress cytokine production	NA	20672047	2010	NA
PRRID_0844	Whole bacteria Click for more detail	Legionella pneumophila (Bacteria)	NA	NA	Whole organism	Natural	It activates the p38 MAPK and JNK as well as recruitment of NF-	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	Primary human small airway epithelial cells (SAEC)	LRR	O60603.fasta	O60603	784	hBD-2 elicits an antimicrobial effect on L. pneumophila.	ELISA	20154223	2010	Pubchem Assay
PRRID_0844	Whole bacteria Click for more detail	Legionella pneumophila (Bacteria)	NA	NA	Whole organism	Natural	It activates the p38 MAPK and JNK as well as recruitment of NF-	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	Primary human small airway epithelial cells (SAEC)	LRR	O60603.fasta	O60603	784	hBD-2 elicits an antimicrobial effect on L. pneumophila.	ELISA	20154223	2010	Pubchem Assay

previous 1 2...4 5 678 9 10...43 44 next