| Primary information |
|---|
| PRRID | PRRID_0836 |
| Ligand Name | virions |
| Source | EBV(virus) |
| Sequence of ligand | MAKLETVTLGNIGKDGKQTLVLNPRGVNPTNGVASLSQAGAVPALEKRVTVSVSQPSRNRKNYKVQVKIQNPTACTANGSCDPSVTRQAYADVTFSFTQYSTDEERAFVRTELAALLASPLLIDAIDQLNPAY |
| Length | NA |
| Type | Virus |
| Occurence | Natural |
| Role of Ligand | Release of monocyte chemoattractant protein-1 (MCP-1) and to an increase of several cytokine mRNA levels. |
| Name of receptor | Toll-like receptor 2 (TLR2) |
| Type of receptor | Toll-like receptor (TLR) |
| Source | Human |
| Localization | Monocytes |
| Domain | Leucine-rich Repeat (LRR) Domain |
| Sequence of Receptor | O60603.fasta |
| Swiss prot ID | O60603 |
| Length Of Receptor | 784 |
| Function | It provides antiviral immunity. |
| Assay used | NA |
| PMID | 20713890 |
| Year of Publication | 2010 |
| Pubchem assay | Pubchem Assay |
| Primary information |
|---|
| PRRID | PRRID_0836 |
| Ligand Name | virions |
| Source | EBV(virus) |
| Sequence of ligand | MAKLETVTLGNIGKDGKQTLVLNPRGVNPTNGVASLSQAGAVPALEKRVTVSVSQPSRNRKNYKVQVKIQNPTACTANGSCDPSVTRQAYADVTFSFTQYSTDEERAFVRTELAALLASPLLIDAIDQLNPAY |
| Length | NA |
| Type | Virus |
| Occurence | Natural |
| Role of Ligand | Release of monocyte chemoattractant protein-1 (MCP-1) and to an increase of several cytokine mRNA levels. |
| Name of receptor | Toll-like receptor 2 (TLR2) |
| Type of receptor | Toll-like receptor (TLR) |
| Source | Human |
| Localization | Monocytes |
| Domain | Leucine-rich Repeat (LRR) Domain |
| Sequence of Receptor | O60603.fasta |
| Swiss prot ID | O60603 |
| Length Of Receptor | 784 |
| Function | It provides antiviral immunity. |
| Assay used | NA |
| PMID | 20713890 |
| Year of Publication | 2010 |
| Pubchem assay | Pubchem Assay |