| Primary information |
|---|
| PRRID | PRRID_0788 |
| Ligand Name | SE-derived secreted factor (SE-S) |
| Source | Staphylococcus epidermidis strain 1457 (Bacteria) |
| Sequence of ligand | MNYSKITVTLIIILLCTFSFEFSFNRFVQADESRPKIESLKKKSELDSTALYNIKTSYSQDNIILDIKNKTNSTQLLSNDLIFDDITLKEWNKNSLKTEFNSSEIANHFKGKKVDIFGIYYGANCIGEVSKRTGCIYGGITLHEEEKIDQKNSIGVNVFKDGSQQKGFMITTDKKEPTIQELDLKTRKVIQNQYKIYNSETGNIQKGYMEFHSNSSSFYYDLFNFKGKYSVDFLKFYNDNKTINSSNLHIDVYLYSQ |
| Length | 257 |
| Type | Soluble factor |
| Occurence | Natural |
| Role of Ligand | TLR2 mediated SE-induced cytokine production such as TNF, CXCL1 and CXCL2 |
| Name of receptor | Toll-like receptor 2 (TLR2) |
| Type of receptor | Toll-like receptor (TLR) |
| Source | Human |
| Localization | human embryonic kidney cells, human whole blood and murine primary macrophages |
| Domain | Leucine-rich Repeat (LRR) Domain |
| Sequence of Receptor | O60603.fasta |
| Swiss prot ID | O60603 |
| Length Of Receptor | 784 |
| Function | TLR2 mediates recognition of live SE and clearance of SE bacteremia. |
| Assay used | Cytokines assay |
| PMID | 20404927 |
| Year of Publication | 2010 |
| Pubchem assay | Pubchem Assay |
| Primary information |
|---|
| PRRID | PRRID_0788 |
| Ligand Name | SE-derived secreted factor (SE-S) |
| Source | Staphylococcus epidermidis strain 1457 (Bacteria) |
| Sequence of ligand | MNYSKITVTLIIILLCTFSFEFSFNRFVQADESRPKIESLKKKSELDSTALYNIKTSYSQDNIILDIKNKTNSTQLLSNDLIFDDITLKEWNKNSLKTEFNSSEIANHFKGKKVDIFGIYYGANCIGEVSKRTGCIYGGITLHEEEKIDQKNSIGVNVFKDGSQQKGFMITTDKKEPTIQELDLKTRKVIQNQYKIYNSETGNIQKGYMEFHSNSSSFYYDLFNFKGKYSVDFLKFYNDNKTINSSNLHIDVYLYSQ |
| Length | 257 |
| Type | Soluble factor |
| Occurence | Natural |
| Role of Ligand | TLR2 mediated SE-induced cytokine production such as TNF, CXCL1 and CXCL2 |
| Name of receptor | Toll-like receptor 2 (TLR2) |
| Type of receptor | Toll-like receptor (TLR) |
| Source | Human |
| Localization | human embryonic kidney cells, human whole blood and murine primary macrophages |
| Domain | Leucine-rich Repeat (LRR) Domain |
| Sequence of Receptor | O60603.fasta |
| Swiss prot ID | O60603 |
| Length Of Receptor | 784 |
| Function | TLR2 mediates recognition of live SE and clearance of SE bacteremia. |
| Assay used | Cytokines assay |
| PMID | 20404927 |
| Year of Publication | 2010 |
| Pubchem assay | Pubchem Assay |