Primary information |
---|
PRRID | PRRID_0810 |
Ligand Name | Stathmins |
Source | Human (others) |
Sequence of ligand | MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESKDPADETEAD |
Length | 149 |
Type | Endogenous |
Occurence | Natural |
Role of Ligand | Binding of stathmins to TLR3 activates downstream signalling pathways via TRIF and lead to the secretion of IL-6 and CXCL-8 |
Name of receptor | Toll-like receptor 3 (TLR3) |
Type of receptor | Toll-like receptor (TLR) |
Source | Human |
Localization | Astrocytes and microglia |
Domain | Leucine-rich Repeat (LRR) Domain |
Sequence of Receptor | O15455.fasta |
Swiss prot ID | O15455 |
Length Of Receptor | 904 |
Function | It has a role in astrocyte-mediated neuroprotection and in morphogenesis in the CNS |
Assay used | NA |
PMID | 20483774 |
Year of Publication | 2010 |
Pubchem assay | Pubchem Assay |
Primary information |
---|
PRRID | PRRID_0810 |
Ligand Name | Stathmins |
Source | Human (others) |
Sequence of ligand | MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESKDPADETEAD |
Length | 149 |
Type | Endogenous |
Occurence | Natural |
Role of Ligand | Binding of stathmins to TLR3 activates downstream signalling pathways via TRIF and lead to the secretion of IL-6 and CXCL-8 |
Name of receptor | Toll-like receptor 3 (TLR3) |
Type of receptor | Toll-like receptor (TLR) |
Source | Human |
Localization | Astrocytes and microglia |
Domain | Leucine-rich Repeat (LRR) Domain |
Sequence of Receptor | O15455.fasta |
Swiss prot ID | O15455 |
Length Of Receptor | 904 |
Function | It has a role in astrocyte-mediated neuroprotection and in morphogenesis in the CNS |
Assay used | NA |
PMID | 20483774 |
Year of Publication | 2010 |
Pubchem assay | Pubchem Assay |