| Primary information |
|---|
| PRRID | PRRID_0778 |
| Ligand Name | profilin-like protein |
| Source | T. gondii (others) |
| Sequence of ligand | MSDWDPVVKEWLVDTGYCCAGGIANAEDGVVFAAAADDDDGWSKLYKDDHEEDTIGEDGNACGKVSINEASTIKAAVDDGSAPNGVWIGGQKYKVVRPEKGFEYNDCTFDITMCARSKGGAHLIKTPNGSIVIALYDEEKEQDKGNSRTSALAFAEYLHQSGY |
| Length | 163 |
| Type | Protein |
| Occurence | Natural |
| Role of Ligand | Upon recogniton by the TLR, it induces induces the recruitment of adaptor proteins MyD95 |
| Name of receptor | MDA5 |
| Type of receptor | Rig-like receptor (RLR) |
| Source | Human |
| Localization | Cell surface |
| Domain | Leucine-rich Repeat (LRR) Domain |
| Sequence of Receptor | Q53TB6.fasta |
| Swiss prot ID | Q53TB6 |
| Length Of Receptor | 435 |
| Function | It leadsto the secretion of the proinfalmmatory and IFN-‚ç∫ |
| Assay used | NA |
| PMID | 20620129 |
| Year of Publication | 2010 |
| Pubchem assay | Pubchem Assay |
| Primary information |
|---|
| PRRID | PRRID_0778 |
| Ligand Name | profilin-like protein |
| Source | T. gondii (others) |
| Sequence of ligand | MSDWDPVVKEWLVDTGYCCAGGIANAEDGVVFAAAADDDDGWSKLYKDDHEEDTIGEDGNACGKVSINEASTIKAAVDDGSAPNGVWIGGQKYKVVRPEKGFEYNDCTFDITMCARSKGGAHLIKTPNGSIVIALYDEEKEQDKGNSRTSALAFAEYLHQSGY |
| Length | 163 |
| Type | Protein |
| Occurence | Natural |
| Role of Ligand | Upon recogniton by the TLR, it induces induces the recruitment of adaptor proteins MyD95 |
| Name of receptor | MDA5 |
| Type of receptor | Rig-like receptor (RLR) |
| Source | Human |
| Localization | Cell surface |
| Domain | Leucine-rich Repeat (LRR) Domain |
| Sequence of Receptor | Q53TB6.fasta |
| Swiss prot ID | Q53TB6 |
| Length Of Receptor | 435 |
| Function | It leadsto the secretion of the proinfalmmatory and IFN-‚ç∫ |
| Assay used | NA |
| PMID | 20620129 |
| Year of Publication | 2010 |
| Pubchem assay | Pubchem Assay |