Primary information |
---|
PRRID | PRRID_0778 |
Ligand Name | profilin-like protein |
Source | T. gondii (others) |
Sequence of ligand | MSDWDPVVKEWLVDTGYCCAGGIANAEDGVVFAAAADDDDGWSKLYKDDHEEDTIGEDGNACGKVSINEASTIKAAVDDGSAPNGVWIGGQKYKVVRPEKGFEYNDCTFDITMCARSKGGAHLIKTPNGSIVIALYDEEKEQDKGNSRTSALAFAEYLHQSGY |
Length | 163 |
Type | Protein |
Occurence | Natural |
Role of Ligand | Upon recogniton by the TLR, it induces induces the recruitment of adaptor proteins MyD95 |
Name of receptor | MDA5 |
Type of receptor | Rig-like receptor (RLR) |
Source | Human |
Localization | Cell surface |
Domain | Leucine-rich Repeat (LRR) Domain |
Sequence of Receptor | Q53TB6.fasta |
Swiss prot ID | Q53TB6 |
Length Of Receptor | 435 |
Function | It leadsto the secretion of the proinfalmmatory and IFN-‚ç∫ |
Assay used | NA |
PMID | 20620129 |
Year of Publication | 2010 |
Pubchem assay | Pubchem Assay |
Primary information |
---|
PRRID | PRRID_0778 |
Ligand Name | profilin-like protein |
Source | T. gondii (others) |
Sequence of ligand | MSDWDPVVKEWLVDTGYCCAGGIANAEDGVVFAAAADDDDGWSKLYKDDHEEDTIGEDGNACGKVSINEASTIKAAVDDGSAPNGVWIGGQKYKVVRPEKGFEYNDCTFDITMCARSKGGAHLIKTPNGSIVIALYDEEKEQDKGNSRTSALAFAEYLHQSGY |
Length | 163 |
Type | Protein |
Occurence | Natural |
Role of Ligand | Upon recogniton by the TLR, it induces induces the recruitment of adaptor proteins MyD95 |
Name of receptor | MDA5 |
Type of receptor | Rig-like receptor (RLR) |
Source | Human |
Localization | Cell surface |
Domain | Leucine-rich Repeat (LRR) Domain |
Sequence of Receptor | Q53TB6.fasta |
Swiss prot ID | Q53TB6 |
Length Of Receptor | 435 |
Function | It leadsto the secretion of the proinfalmmatory and IFN-‚ç∫ |
Assay used | NA |
PMID | 20620129 |
Year of Publication | 2010 |
Pubchem assay | Pubchem Assay |