| Primary information |
|---|
| PRRID | PRRID_0250 |
| Ligand Name | Small Heat Shock Protein B8 (HSP22) |
| Source | Host (Endogenous) (others) |
| Sequence of ligand | MADGQMPFSCHYPSRLRRDPFRDSPLSSRLLDDGFGMDPFPDDLTASWPDWALPRLSSAWPGTLRSGMVPRGPTATARFGVPAEGRTPPPFPGEPWKVCVNVHSFKPEELMVKTKDGYVEVSGKHEEKQQEGGIVSKNFTKKIQLPAEVDPVTVFASLSPEGLLIIEAPQVPPYSTFGESSFNNELPQDSQEVTCT |
| Length | 496 |
| Type | Protein |
| Occurence | Natural |
| Role of Ligand | It leads to the increased production of the inflammatory mediators TNF-alpha, IL-6, IL-10, and IL-12p70. |
| Name of receptor | Toll-like receptor 4 (TLR4) |
| Type of receptor | Toll-like receptor (TLR) |
| Source | Human |
| Localization | Synovial tissue |
| Domain | NA |
| Sequence of Receptor | O00206.fasta |
| Swiss prot ID | O00206 |
| Length Of Receptor | 839 |
| Function | It leads to the activationa and maturation of the dendritic cells |
| Assay used | Cyokine assay |
| PMID | 16709864 |
| Year of Publication | 2006 |
| Pubchem assay | Pubchem Assay |
| Primary information |
|---|
| PRRID | PRRID_0250 |
| Ligand Name | Small Heat Shock Protein B8 (HSP22) |
| Source | Host (Endogenous) (others) |
| Sequence of ligand | MADGQMPFSCHYPSRLRRDPFRDSPLSSRLLDDGFGMDPFPDDLTASWPDWALPRLSSAWPGTLRSGMVPRGPTATARFGVPAEGRTPPPFPGEPWKVCVNVHSFKPEELMVKTKDGYVEVSGKHEEKQQEGGIVSKNFTKKIQLPAEVDPVTVFASLSPEGLLIIEAPQVPPYSTFGESSFNNELPQDSQEVTCT |
| Length | 496 |
| Type | Protein |
| Occurence | Natural |
| Role of Ligand | It leads to the increased production of the inflammatory mediators TNF-alpha, IL-6, IL-10, and IL-12p70. |
| Name of receptor | Toll-like receptor 4 (TLR4) |
| Type of receptor | Toll-like receptor (TLR) |
| Source | Human |
| Localization | Synovial tissue |
| Domain | NA |
| Sequence of Receptor | O00206.fasta |
| Swiss prot ID | O00206 |
| Length Of Receptor | 839 |
| Function | It leads to the activationa and maturation of the dendritic cells |
| Assay used | Cyokine assay |
| PMID | 16709864 |
| Year of Publication | 2006 |
| Pubchem assay | Pubchem Assay |