Primary information |
---|
PRRID | PRRID_0250 |
Ligand Name | Small Heat Shock Protein B8 (HSP22) |
Source | Host (Endogenous) (others) |
Sequence of ligand | MADGQMPFSCHYPSRLRRDPFRDSPLSSRLLDDGFGMDPFPDDLTASWPDWALPRLSSAWPGTLRSGMVPRGPTATARFGVPAEGRTPPPFPGEPWKVCVNVHSFKPEELMVKTKDGYVEVSGKHEEKQQEGGIVSKNFTKKIQLPAEVDPVTVFASLSPEGLLIIEAPQVPPYSTFGESSFNNELPQDSQEVTCT |
Length | 496 |
Type | Protein |
Occurence | Natural |
Role of Ligand | It leads to the increased production of the inflammatory mediators TNF-alpha, IL-6, IL-10, and IL-12p70. |
Name of receptor | Toll-like receptor 4 (TLR4) |
Type of receptor | Toll-like receptor (TLR) |
Source | Human |
Localization | Synovial tissue |
Domain | NA |
Sequence of Receptor | O00206.fasta |
Swiss prot ID | O00206 |
Length Of Receptor | 839 |
Function | It leads to the activationa and maturation of the dendritic cells |
Assay used | Cyokine assay |
PMID | 16709864 |
Year of Publication | 2006 |
Pubchem assay | Pubchem Assay |
Primary information |
---|
PRRID | PRRID_0250 |
Ligand Name | Small Heat Shock Protein B8 (HSP22) |
Source | Host (Endogenous) (others) |
Sequence of ligand | MADGQMPFSCHYPSRLRRDPFRDSPLSSRLLDDGFGMDPFPDDLTASWPDWALPRLSSAWPGTLRSGMVPRGPTATARFGVPAEGRTPPPFPGEPWKVCVNVHSFKPEELMVKTKDGYVEVSGKHEEKQQEGGIVSKNFTKKIQLPAEVDPVTVFASLSPEGLLIIEAPQVPPYSTFGESSFNNELPQDSQEVTCT |
Length | 496 |
Type | Protein |
Occurence | Natural |
Role of Ligand | It leads to the increased production of the inflammatory mediators TNF-alpha, IL-6, IL-10, and IL-12p70. |
Name of receptor | Toll-like receptor 4 (TLR4) |
Type of receptor | Toll-like receptor (TLR) |
Source | Human |
Localization | Synovial tissue |
Domain | NA |
Sequence of Receptor | O00206.fasta |
Swiss prot ID | O00206 |
Length Of Receptor | 839 |
Function | It leads to the activationa and maturation of the dendritic cells |
Assay used | Cyokine assay |
PMID | 16709864 |
Year of Publication | 2006 |
Pubchem assay | Pubchem Assay |