Browse result page of PRRDB 2.0

PRRID	Name of Ligand	Source of ligand	Sequence of Ligand	Length of Ligand	Type of Ligand	Occurence	Role of Ligand	Name of Receptor	Type of Reeptor	Source of the Receptor	Localization	Domain	Sequence of Receptor	Swiss prot ID	Length of receptor	Function of Receptor	Assay used	PMID	Year of publication	Pubchem assay
PRRID_0815	T4SS Click for more detail	Gram-negative bacteria	NA	NA	Protein	Natural	It activates caspase 1 dependent IL-1Œ≤ and IL-18 secretion in response.	Nod-like receptor C4 (NLRC4)	NOD-like receptor (NLR)	NA	NA	NA	NA	NA	NA	It act as VAMPs, which results into the clearance of the pathogen due to the activation of the immune systems	NA	20349122	2010	NA
PRRID_0815	T4SS Click for more detail	Gram-negative bacteria	NA	NA	Protein	Natural	It activates caspase 1 dependent IL-1Œ≤ and IL-18 secretion in response.	Nod-like receptor C4 (NLRC4)	NOD-like receptor (NLR)	NA	NA	NA	NA	NA	NA	It act as VAMPs, which results into the clearance of the pathogen due to the activation of the immune systems	NA	20349122	2010	NA
PRRID_0823	type III or IV secretion systems Click for more detail	Salmonella typhimurium, Shigella flexneri, Legionella pneumophila and Pseudomonas aeruginosa (Bacter	NA	NA	Protein	Natural	It‚Äôs binding to the NLRP1 leads to the activation of caspase-1,	IPAF	NOD-like receptor (NLR)	NA	NA	NA	NA	NA	NA	IPAF-dependent caspase-1 activation is accompanied by rapid cell death	ELISA	20133635	2010	NA
PRRID_0823	type III or IV secretion systems Click for more detail	Salmonella typhimurium, Shigella flexneri, Legionella pneumophila and Pseudomonas aeruginosa (Bacter	NA	NA	Protein	Natural	It‚Äôs binding to the NLRP1 leads to the activation of caspase-1,	IPAF	NOD-like receptor (NLR)	NA	NA	NA	NA	NA	NA	IPAF-dependent caspase-1 activation is accompanied by rapid cell death	ELISA	20133635	2010	NA
PRRID_0868	alum (aluminium adjuvants ) Click for more detail	NA	O.O.O.O.O.O.O.O.O.O.O.O.[O-]S(=O)(=O)[O-].[O-]S(=O)(=O)[O-].[Al+3].[K+]	NA	NA	Synthetic	NA	Nucleotide-binding oligomerization domain, Leucine rich Repeat and Pyrin domain containing3 (Nalp3)	NOD-like receptor (NLR)	Human	Eosinophils	NA	Q96P20.fasta	Q96P20	1036	NLRP3 responds to microbial products and host-derived danger signals and activates the caspase-1- dependent inflammasome	real-time reverse transcription-PCR, FACS, ELISA	21978001	2011	Pubchem Assay
PRRID_0868	alum (aluminium adjuvants ) Click for more detail	NA	O.O.O.O.O.O.O.O.O.O.O.O.[O-]S(=O)(=O)[O-].[O-]S(=O)(=O)[O-].[Al+3].[K+]	NA	NA	Synthetic	NA	Nucleotide-binding oligomerization domain, Leucine rich Repeat and Pyrin domain containing3 (Nalp3)	NOD-like receptor (NLR)	Human	Eosinophils	NA	Q96P20.fasta	Q96P20	1036	NLRP3 responds to microbial products and host-derived danger signals and activates the caspase-1- dependent inflammasome	real-time reverse transcription-PCR, FACS, ELISA	21978001	2011	Pubchem Assay
PRRID_0869	alum (aluminium adjuvants ) Click for more detail	NA	O.O.O.O.O.O.O.O.O.O.O.O.[O-]S(=O)(=O)[O-].[O-]S(=O)(=O)[O-].[Al+3].[K+]	NA	NA	Synthetic	NA	Nucleotide-binding oligomerization domain, Leucine rich Repeat and Pyrin domain containing3 (Nalp3)	NOD-like receptor (NLR)	Balb/c mice	Spleen and lung	NA	Q8R4B8.fasta	Q8R4B8	1033	NLRP3 responds to microbial products and host-derived danger signals and activates the caspase-1- dependent inflammasome	ELISA	21963872	2011	Pubchem Assay
PRRID_0869	alum (aluminium adjuvants ) Click for more detail	NA	O.O.O.O.O.O.O.O.O.O.O.O.[O-]S(=O)(=O)[O-].[O-]S(=O)(=O)[O-].[Al+3].[K+]	NA	NA	Synthetic	NA	Nucleotide-binding oligomerization domain, Leucine rich Repeat and Pyrin domain containing3 (Nalp3)	NOD-like receptor (NLR)	Balb/c mice	Spleen and lung	NA	Q8R4B8.fasta	Q8R4B8	1033	NLRP3 responds to microbial products and host-derived danger signals and activates the caspase-1- dependent inflammasome	ELISA	21963872	2011	Pubchem Assay
PRRID_0911	iE-DAP (gamma-D-glutamyl-meso diaminopimelic acid) Click for more detail	Bacteria	N[C@@H](CCC[C@@H](NC(=O)CC[C@@H](N)C(O)=O)C(O)=O)C(O)=O	NA	Pattern-associated molecular patterns (PAMPs)	Natural	peptidoglycan substructures	Nucleotide Binding Oligomerization Domain Containing 1 (Nod1)	NOD-like receptor (NLR)	Human	Eosinophils	NA	Q9Y239.fasta	Q9Y239	953	play key roles in regulation of¬†innate immune response. NLRs can cooperate with¬†Toll-like receptors¬†and regulate inflammatory and apoptotic response.	real-time reverse transcription-PCR, FACS, ELISA	21978001	2011	Pubchem Assay
PRRID_0911	iE-DAP (gamma-D-glutamyl-meso diaminopimelic acid) Click for more detail	Bacteria	N[C@@H](CCC[C@@H](NC(=O)CC[C@@H](N)C(O)=O)C(O)=O)C(O)=O	NA	Pattern-associated molecular patterns (PAMPs)	Natural	peptidoglycan substructures	Nucleotide Binding Oligomerization Domain Containing 1 (Nod1)	NOD-like receptor (NLR)	Human	Eosinophils	NA	Q9Y239.fasta	Q9Y239	953	play key roles in regulation of¬†innate immune response. NLRs can cooperate with¬†Toll-like receptors¬†and regulate inflammatory and apoptotic response.	real-time reverse transcription-PCR, FACS, ELISA	21978001	2011	Pubchem Assay
PRRID_0935	MDP (muramyldipeptide) Click for more detail	Gram-negative and Gram-positive bacteria	CC(C(=O)NC(CCC(=O)O)C(=O)N)NC(=O)C(C)OC1C(C(OC(C1O)CO)O)NC(=O)C	NA	Peptide	Natural	leads to cytokine activation, especially¬†IL-1Œ±¬†and¬†IL-1Œ≤.	Nucleotide-binding oligomerization domain, Leucine rich Repeat and Pyrin domain containing3 (Nalp3)	NOD-like receptor (NLR)	Human	Eosinophils	NA	Q96P20.fasta	Q96P20	1036	recognizes fragments of the bacterial cell wall	real-time reverse transcription-PCR, FACS, ELISA	21978001	2011	Pubchem Assay
PRRID_0935	MDP (muramyldipeptide) Click for more detail	Gram-negative and Gram-positive bacteria	CC(C(=O)NC(CCC(=O)O)C(=O)N)NC(=O)C(C)OC1C(C(OC(C1O)CO)O)NC(=O)C	NA	Peptide	Natural	leads to cytokine activation, especially¬†IL-1Œ±¬†and¬†IL-1Œ≤.	Nucleotide-binding oligomerization domain, Leucine rich Repeat and Pyrin domain containing3 (Nalp3)	NOD-like receptor (NLR)	Human	Eosinophils	NA	Q96P20.fasta	Q96P20	1036	recognizes fragments of the bacterial cell wall	real-time reverse transcription-PCR, FACS, ELISA	21978001	2011	Pubchem Assay
PRRID_0939	Paclitaxel Click for more detail	Pacific yew (plant)	C1=C2C(C(=O)C3(C(CC4C(C3C(C(C2(C)C)(CC1OC(=O)C(C(C5=CC=CC=C5)NC(=O)C6=CC=CC=C6)O)O)OC(=O)C7=CC=CC=C7)(CO4)OC(=O)C)O)C)OC(=O)C	NA	Pattern-associated molecular patterns (PAMPs)	Synthetic	used to treat a number of types of¬†cancer	Nucleotide Binding Oligomerization Domain Containing 2 (Nod2)	NOD-like receptor (NLR)	Human	Myeloid cells, microglia, astrocytes, neurons	NA	Q9HC29.fasta	Q9HC29	1040	TLR 4 leads to an intracellular signaling pathway¬†NF-Œ∫B and inflammatory cytokine production which is responsible for activating the innate immune system	NA	21982558	2011	Pubchem Assay
PRRID_0939	Paclitaxel Click for more detail	Pacific yew (plant)	C1=C2C(C(=O)C3(C(CC4C(C3C(C(C2(C)C)(CC1OC(=O)C(C(C5=CC=CC=C5)NC(=O)C6=CC=CC=C6)O)O)OC(=O)C7=CC=CC=C7)(CO4)OC(=O)C)O)C)OC(=O)C	NA	Pattern-associated molecular patterns (PAMPs)	Synthetic	used to treat a number of types of¬†cancer	Nucleotide Binding Oligomerization Domain Containing 2 (Nod2)	NOD-like receptor (NLR)	Human	Myeloid cells, microglia, astrocytes, neurons	NA	Q9HC29.fasta	Q9HC29	1040	TLR 4 leads to an intracellular signaling pathway¬†NF-Œ∫B and inflammatory cytokine production which is responsible for activating the innate immune system	NA	21982558	2011	Pubchem Assay
PRRID_0977	ATP Click for more detail	NA	C1=NC2=C(C(=N1)N)N=CN2C3C(C(C(O3)COP(=O)(O)OP(=O)(O)OP(=O)(O)O)O)O	NA	Small molecule	Natural	immunostimulant	Nucleotide Binding Oligomerization Domain Containing 2 (Nod2)	NOD-like receptor (NLR)	Human	PBMCs	NA	Q9HC29.fasta	Q9HC29	1040	induction of IL-6 and IL-8	ELISA	22998942	2012	Pubchem Assay
PRRID_0977	ATP Click for more detail	NA	C1=NC2=C(C(=N1)N)N=CN2C3C(C(C(O3)COP(=O)(O)OP(=O)(O)OP(=O)(O)O)O)O	NA	Small molecule	Natural	immunostimulant	Nucleotide Binding Oligomerization Domain Containing 2 (Nod2)	NOD-like receptor (NLR)	Human	PBMCs	NA	Q9HC29.fasta	Q9HC29	1040	induction of IL-6 and IL-8	ELISA	22998942	2012	Pubchem Assay
PRRID_1004	Mitochondrial DNA Click for more detail	NA	NA	NA	NA	Natural	Immunostimulant	Nod-like receptor P3 (NLRP3)	NOD-like receptor (NLR)	NA	NA	NA	NA	NA	NA	TLR9 antagonists	NA	22998942	2012	NA
PRRID_1004	Mitochondrial DNA Click for more detail	NA	NA	NA	NA	Natural	Immunostimulant	Nod-like receptor P3 (NLRP3)	NOD-like receptor (NLR)	NA	NA	NA	NA	NA	NA	TLR9 antagonists	NA	22998942	2012	NA
PRRID_1021	ATP Click for more detail	NA	C1=NC2=C(C(=N1)N)N=CN2C3C(C(C(O3)COP(=O)(O)OP(=O)(O)OP(=O)(O)O)O)O	NA	Damage-associated molecular patterns (DAMPs)	Natural	triggers immune responses	Nod-like receptor protein 3 (P2X7R) (NLRP3 (P2X7R)	NOD-like receptor (NLR)	Mice	graft-versus-host disease (GVHD)	NA	Q8BHB0.fasta	Q8BHB0	953	Blockade of ATP-P2X7R signaling pathways decreased acute GVHD	NA	23985302	2013	Pubchem Assay
PRRID_1021	ATP Click for more detail	NA	C1=NC2=C(C(=N1)N)N=CN2C3C(C(C(O3)COP(=O)(O)OP(=O)(O)OP(=O)(O)O)O)O	NA	Damage-associated molecular patterns (DAMPs)	Natural	triggers immune responses	Nod-like receptor protein 3 (P2X7R) (NLRP3 (P2X7R)	NOD-like receptor (NLR)	Mice	graft-versus-host disease (GVHD)	NA	Q8BHB0.fasta	Q8BHB0	953	Blockade of ATP-P2X7R signaling pathways decreased acute GVHD	NA	23985302	2013	Pubchem Assay
PRRID_1022	ATP Click for more detail	NA	C1=NC2=C(C(=N1)N)N=CN2C3C(C(C(O3)COP(=O)(O)OP(=O)(O)OP(=O)(O)O)O)O	NA	Damage-associated molecular patterns (DAMPs)	Natural	triggers immune responses	Nod-like receptor protein 3 (P2X7R) (NLRP3 (P2X7R)	NOD-like receptor (NLR)	Human	graft-versus-host disease (GVHD)	NA	Q96P20.fasta	Q96P20	1036	Polymorphisms of P2X7R, NALP2 and NALP3 are associated with OS	NA	23985302	2013	Pubchem Assay
PRRID_1022	ATP Click for more detail	NA	C1=NC2=C(C(=N1)N)N=CN2C3C(C(C(O3)COP(=O)(O)OP(=O)(O)OP(=O)(O)O)O)O	NA	Damage-associated molecular patterns (DAMPs)	Natural	triggers immune responses	Nod-like receptor protein 3 (P2X7R) (NLRP3 (P2X7R)	NOD-like receptor (NLR)	Human	graft-versus-host disease (GVHD)	NA	Q96P20.fasta	Q96P20	1036	Polymorphisms of P2X7R, NALP2 and NALP3 are associated with OS	NA	23985302	2013	Pubchem Assay
PRRID_1110	muramyl dipeptide (MDP) Click for more detail	Gram-positive and negative bacteria	CC(C(=O)NC(CCC(=O)O)C(=O)N)NC(=O)C(C)OC1C(C(OC(C1O)CO)O)NC(=O)C	NA	Peptide	Natural	a component of bacterial peptidoglycan, and induces NF-jB activation, leading to enhanced Th1 responses	Nucleotide Binding Oligomerization Domain Containing 2 (Nod2)	NOD-like receptor (NLR)	Mice	graft-versus-host disease (GVHD)	NA	Q8K3Z0.fasta	Q8K3Z0	1020	NOD2 functions as a primary sensor of microbial products inducing inflammatory T-cell responses and also negatively regulates TLR-mediated responses	NA	23985302	2013	Pubchem_assay
PRRID_1110	muramyl dipeptide (MDP) Click for more detail	Gram-positive and negative bacteria	CC(C(=O)NC(CCC(=O)O)C(=O)N)NC(=O)C(C)OC1C(C(OC(C1O)CO)O)NC(=O)C	NA	Peptide	Natural	a component of bacterial peptidoglycan, and induces NF-jB activation, leading to enhanced Th1 responses	Nucleotide Binding Oligomerization Domain Containing 2 (Nod2)	NOD-like receptor (NLR)	Mice	graft-versus-host disease (GVHD)	NA	Q8K3Z0.fasta	Q8K3Z0	1020	NOD2 functions as a primary sensor of microbial products inducing inflammatory T-cell responses and also negatively regulates TLR-mediated responses	NA	23985302	2013	Pubchem_assay
PRRID_1130	muramyl dipeptide (MDP) Click for more detail	Gram-positive and negative bacteria	CC(C(=O)NC(CCC(=O)O)C(=O)N)NC(=O)C(C)OC1C(C(OC(C1O)CO)O)NC(=O)C	NA	Peptide	Natural	a component of bacterial peptidoglycan, and induces NF-jB activation, leading to enhanced Th1 responses	Nod-like receptor protein 3 (P2X7R) (NLRP3 (P2X7R)	NOD-like receptor (NLR)	Human	graft-versus-host disease (GVHD)	NA	Q96P20.fasta	Q96P20	1036	NOD2 functions as a primary sensor of microbial products inducing inflammatory T-cell responses and also negatively regulates TLR-mediated responses	NA	23985302	2013	Pubchem_assay
PRRID_1130	muramyl dipeptide (MDP) Click for more detail	Gram-positive and negative bacteria	CC(C(=O)NC(CCC(=O)O)C(=O)N)NC(=O)C(C)OC1C(C(OC(C1O)CO)O)NC(=O)C	NA	Peptide	Natural	a component of bacterial peptidoglycan, and induces NF-jB activation, leading to enhanced Th1 responses	Nod-like receptor protein 3 (P2X7R) (NLRP3 (P2X7R)	NOD-like receptor (NLR)	Human	graft-versus-host disease (GVHD)	NA	Q96P20.fasta	Q96P20	1036	NOD2 functions as a primary sensor of microbial products inducing inflammatory T-cell responses and also negatively regulates TLR-mediated responses	NA	23985302	2013	Pubchem_assay
PRRID_1180	amidation of the mesoDAP Click for more detail	PGN of Gram-positive bacteria	C(CC(C(=O)O)N)CC(C(=O)O)N	NA	Protein	Natural	activates NOD2 but not recognised by NOD2	Nod-like receptor protein 3 (P2X7R) (NLRP3 (P2X7R)	NOD-like receptor (NLR)	Mice	most adult tissues	intracellular receptors	Q8BHB0.fasta	Q8BHB0	953	play key roles in regulation of innate immune response. NLRs can cooperate with Toll-like receptors and regulate inflammatory and apoptotic response.	NA	24779390	2014	Pubchem_assay
PRRID_1180	amidation of the mesoDAP Click for more detail	PGN of Gram-positive bacteria	C(CC(C(=O)O)N)CC(C(=O)O)N	NA	Protein	Natural	activates NOD2 but not recognised by NOD2	Nod-like receptor protein 3 (P2X7R) (NLRP3 (P2X7R)	NOD-like receptor (NLR)	Mice	most adult tissues	intracellular receptors	Q8BHB0.fasta	Q8BHB0	953	play key roles in regulation of innate immune response. NLRs can cooperate with Toll-like receptors and regulate inflammatory and apoptotic response.	NA	24779390	2014	Pubchem_assay
PRRID_1181	amidation of the mesoDAP Click for more detail	PGN of Gram-positive bacteria	C(CC(C(=O)O)N)CC(C(=O)O)N	NA	Protein	Natural	activates NOD2 but not recognised by NOD2	CAD	NOD-like receptor (NLR)	Human	most adult tissues	intracellular receptors	Q9Y239.fasta	Q9Y239	953	play key roles in regulation of innate immune response. NLRs can cooperate with Toll-like receptors and regulate inflammatory and apoptotic response.	NA	24779390	2014	Pubchem_assay
PRRID_1181	amidation of the mesoDAP Click for more detail	PGN of Gram-positive bacteria	C(CC(C(=O)O)N)CC(C(=O)O)N	NA	Protein	Natural	activates NOD2 but not recognised by NOD2	CAD	NOD-like receptor (NLR)	Human	most adult tissues	intracellular receptors	Q9Y239.fasta	Q9Y239	953	play key roles in regulation of innate immune response. NLRs can cooperate with Toll-like receptors and regulate inflammatory and apoptotic response.	NA	24779390	2014	Pubchem_assay
PRRID_1182	anti-citrullinated protein antibody-positive (ACPA+) RA. Click for more detail	Present in the majority of patients with Rheumatoid arthritis (others)	NA	NA	NA	Natural	NA	Caspase-1	NOD-like receptor (NLR)	Human	mast cells	NA	B4DVD8.fasta	B4DVD8	301	contribute to the protective functions of the immune cells	Flow cytometry	24818634	2014	Pubchem_assay
PRRID_1182	anti-citrullinated protein antibody-positive (ACPA+) RA. Click for more detail	Present in the majority of patients with Rheumatoid arthritis (others)	NA	NA	NA	Natural	NA	Caspase-1	NOD-like receptor (NLR)	Human	mast cells	NA	B4DVD8.fasta	B4DVD8	301	contribute to the protective functions of the immune cells	Flow cytometry	24818634	2014	Pubchem_assay
PRRID_1184	bacterial RNA Click for more detail	Bacteria	NA	NA	Nucleic Acid	Natural	elicit innate immune response	Nod-like receptor protein 1 (NLRP1)	NOD-like receptor (NLR)	Human	plasmacytoid and myeloid DCs	extracellular domain (ECD)	Q9NYK1.fasta	Q9NYK1	1049	controlling antiviral host defense or autoimmune diseases and TLR8 and respond to its activation with TNF production and/or degranulation	Microarray analysis, Quantitative PCR, Phosphoproteomic screen, Confocal cell imaging,RNA40 pull-down assay and Immunoblot	24813206	2014	Pubchem_assay
PRRID_1184	bacterial RNA Click for more detail	Bacteria	NA	NA	Nucleic Acid	Natural	elicit innate immune response	Nod-like receptor protein 1 (NLRP1)	NOD-like receptor (NLR)	Human	plasmacytoid and myeloid DCs	extracellular domain (ECD)	Q9NYK1.fasta	Q9NYK1	1049	controlling antiviral host defense or autoimmune diseases and TLR8 and respond to its activation with TNF production and/or degranulation	Microarray analysis, Quantitative PCR, Phosphoproteomic screen, Confocal cell imaging,RNA40 pull-down assay and Immunoblot	24813206	2014	Pubchem_assay
PRRID_1185	Viral RNA Click for more detail	Bacteria	NA	NA	Nucleic Acid	Natural	elicit innate immune response	Nod-like receptor P3 (NLRP3)	NOD-like receptor (NLR)	Human	plasmacytoid and myeloid DCs	extracellular domain (ECD)	Q9NYK1.fasta	Q9NYK1	1049	controlling antiviral host defense or autoimmune diseases and TLR8 and respond to its activation with TNF production and/or degranulation	Microarray analysis, Quantitative PCR, Phosphoproteomic screen, Confocal cell imaging,RNA40 pull-down assay and Immunoblot	24813206	2014	Pubchem_assay
PRRID_1185	Viral RNA Click for more detail	Bacteria	NA	NA	Nucleic Acid	Natural	elicit innate immune response	Nod-like receptor P3 (NLRP3)	NOD-like receptor (NLR)	Human	plasmacytoid and myeloid DCs	extracellular domain (ECD)	Q9NYK1.fasta	Q9NYK1	1049	controlling antiviral host defense or autoimmune diseases and TLR8 and respond to its activation with TNF production and/or degranulation	Microarray analysis, Quantitative PCR, Phosphoproteomic screen, Confocal cell imaging,RNA40 pull-down assay and Immunoblot	24813206	2014	Pubchem_assay
PRRID_1186	bacterialRNA Click for more detail	Bacteria	NA	NA	Nucleic Acid	Natural	elicit innate immune response	Nod-like receptor protein 12(NLRP12)	NOD-like receptor (NLR)	Human	plasmacytoid and myeloid DCs	extracellular domain (ECD)	Q9NR97.fasta	Q9NR97	1041	controlling antiviral host defense or autoimmune diseases and TLR8 and respond to its activation with TNF production and/or degranulation	Microarray analysis, Quantitative PCR, Phosphoproteomic screen, Confocal cell imaging,RNA40 pull-down assay and Immunoblot	24813206	2014	Pubchem_assay
PRRID_1186	bacterialRNA Click for more detail	Bacteria	NA	NA	Nucleic Acid	Natural	elicit innate immune response	Nod-like receptor protein 12(NLRP12)	NOD-like receptor (NLR)	Human	plasmacytoid and myeloid DCs	extracellular domain (ECD)	Q9NR97.fasta	Q9NR97	1041	controlling antiviral host defense or autoimmune diseases and TLR8 and respond to its activation with TNF production and/or degranulation	Microarray analysis, Quantitative PCR, Phosphoproteomic screen, Confocal cell imaging,RNA40 pull-down assay and Immunoblot	24813206	2014	Pubchem_assay
PRRID_1192	CARDs Click for more detail	Bacteria	NA	NA	Protein	Natural	NA	CAD	NOD-like receptor (NLR)	NA	NA	NA	NA	NA	NA	NA	NA	25520185	2014	NA
PRRID_1192	CARDs Click for more detail	Bacteria	NA	NA	Protein	Natural	NA	CAD	NOD-like receptor (NLR)	NA	NA	NA	NA	NA	NA	NA	NA	25520185	2014	NA
PRRID_1193	CARDs Click for more detail	Bacteria	NA	NA	Protein	Natural	NA	Caspase-1	NOD-like receptor (NLR)	NA	NA	NA	NA	NA	NA	NA	NA	25520185	2014	NA
PRRID_1193	CARDs Click for more detail	Bacteria	NA	NA	Protein	Natural	NA	Caspase-1	NOD-like receptor (NLR)	NA	NA	NA	NA	NA	NA	NA	NA	25520185	2014	NA
PRRID_1194	CARDs Click for more detail	Bacteria	NA	NA	Protein	Natural	NA	HSP90	NOD-like receptor (NLR)	NA	NA	NA	NA	NA	NA	NA	NA	25520185	2014	NA
PRRID_1194	CARDs Click for more detail	Bacteria	NA	NA	Protein	Natural	NA	HSP90	NOD-like receptor (NLR)	NA	NA	NA	NA	NA	NA	NA	NA	25520185	2014	NA
PRRID_1195	CARDs Click for more detail	Bacteria	NA	NA	Protein	Natural	NA	Nod-like receptor protein 1 (NLRP1)	NOD-like receptor (NLR)	NA	NA	NA	NA	NA	NA	NA	NA	25520185	2014	NA
PRRID_1195	CARDs Click for more detail	Bacteria	NA	NA	Protein	Natural	NA	Nod-like receptor protein 1 (NLRP1)	NOD-like receptor (NLR)	NA	NA	NA	NA	NA	NA	NA	NA	25520185	2014	NA
PRRID_1196	CARDs Click for more detail	Bacteria	NA	NA	Protein	Natural	NA	Nod-like receptor P3 (NLRP3)	NOD-like receptor (NLR)	NA	NA	NA	NA	NA	NA	NA	NA	25520185	2014	NA
PRRID_1196	CARDs Click for more detail	Bacteria	NA	NA	Protein	Natural	NA	Nod-like receptor P3 (NLRP3)	NOD-like receptor (NLR)	NA	NA	NA	NA	NA	NA	NA	NA	25520185	2014	NA
PRRID_1197	CARDs Click for more detail	Bacteria	NA	NA	Protein	Natural	NA	Nod-like receptor protein 12 (NLRP12)	NOD-like receptor (NLR)	NA	NA	NA	NA	NA	NA	NA	NA	25520185	2014	NA
PRRID_1197	CARDs Click for more detail	Bacteria	NA	NA	Protein	Natural	NA	Nod-like receptor protein 12 (NLRP12)	NOD-like receptor (NLR)	NA	NA	NA	NA	NA	NA	NA	NA	25520185	2014	NA
PRRID_1199	CARDs Click for more detail	Bacteria	NA	NA	Protein	Natural	NA	SOCS-3	NOD-like receptor (NLR)	NA	NA	NA	NA	NA	NA	NA	NA	25520185	2014	NA
PRRID_1199	CARDs Click for more detail	Bacteria	NA	NA	Protein	Natural	NA	SOCS-3	NOD-like receptor (NLR)	NA	NA	NA	NA	NA	NA	NA	NA	25520185	2014	NA
PRRID_1202	LRR Click for more detail	Bacteria	NA	NA	Protein	Natural	NA	DUOX2	NOD-like receptor (NLR)	NA	NA	NA	NA	NA	NA	NA	NA	25520185	2014	NA
PRRID_1202	LRR Click for more detail	Bacteria	NA	NA	Protein	Natural	NA	DUOX2	NOD-like receptor (NLR)	NA	NA	NA	NA	NA	NA	NA	NA	25520185	2014	NA
PRRID_1203	CARDS Click for more detail	Bacteria	NA	NA	Protein	Natural	NA	FRMPD2	NOD-like receptor (NLR)	NA	NA	NA	NA	NA	NA	NA	NA	25520185	2014	NA
PRRID_1203	CARDS Click for more detail	Bacteria	NA	NA	Protein	Natural	NA	FRMPD2	NOD-like receptor (NLR)	NA	NA	NA	NA	NA	NA	NA	NA	25520185	2014	NA
PRRID_1364	iE-DAP (gamma-D-glutamyl-meso diaminopimelic acid) Click for more detail	Gram-negative and Gram-positive bacteria	N[C@@H](CCC[C@@H](NC(=O)CC[C@@H](N)C(O)=O)C(O)=O)C(O)=O	NA	Pattern-associated molecular patterns (PAMPs)	Natural	activate NF-Œ∫B	Nucleotide Binding Oligomerization Domain Containing 1 (Nod1)	NOD-like receptor (NLR)	European and African Children	signals via a caspase- activated recruitment domain (CARD)	signals via a caspase- activated recruitment domain (CARD)	Q9Y239.fasta	Q9Y239	953	plays a fundamental role in pathogen recognition and activation of innate immunity	ELISA	24743542	2014	Pubchem_assay
PRRID_1364	iE-DAP (gamma-D-glutamyl-meso diaminopimelic acid) Click for more detail	Gram-negative and Gram-positive bacteria	N[C@@H](CCC[C@@H](NC(=O)CC[C@@H](N)C(O)=O)C(O)=O)C(O)=O	NA	Pattern-associated molecular patterns (PAMPs)	Natural	activate NF-Œ∫B	Nucleotide Binding Oligomerization Domain Containing 1 (Nod1)	NOD-like receptor (NLR)	European and African Children	signals via a caspase- activated recruitment domain (CARD)	signals via a caspase- activated recruitment domain (CARD)	Q9Y239.fasta	Q9Y239	953	plays a fundamental role in pathogen recognition and activation of innate immunity	ELISA	24743542	2014	Pubchem_assay
PRRID_1381	internalized flagellin Click for more detail	Salmonella typhimurium or Legionella pneumophila (Bacteria)	KLSFEDKNGKVIDGGYAVKMGDDFYAATYDEKTGAITAKTTTYTDGTGVAQTGAVKFGGANGKSEVVTATDGKTYL	76	Protein	Natural	Flagellin and LPS stimulate the production of CXCL1 and CXCL2	Nod-like receptor C4 (NLRC4)	NOD-like receptor (NLR)	Mice	medullary collecting duct (MCD) cells	intracellular receptors	Q3UP24.fasta	Q3UP24	1024	assemble in an inflammasome complex to activate caspase-1 and promote the release of IL-1Œ≤ and IL-18	ELISA, adhesion and invasion assay	24779433	2014	Pubchem_assay
PRRID_1381	internalized flagellin Click for more detail	Salmonella typhimurium or Legionella pneumophila (Bacteria)	KLSFEDKNGKVIDGGYAVKMGDDFYAATYDEKTGAITAKTTTYTDGTGVAQTGAVKFGGANGKSEVVTATDGKTYL	76	Protein	Natural	Flagellin and LPS stimulate the production of CXCL1 and CXCL2	Nod-like receptor C4 (NLRC4)	NOD-like receptor (NLR)	Mice	medullary collecting duct (MCD) cells	intracellular receptors	Q3UP24.fasta	Q3UP24	1024	assemble in an inflammasome complex to activate caspase-1 and promote the release of IL-1Œ≤ and IL-18	ELISA, adhesion and invasion assay	24779433	2014	Pubchem_assay
PRRID_1382	internalized flagellin Click for more detail	Salmonella typhimurium or Legionella pneumophila (Bacteria)	KLSFEDKNGKVIDGGYAVKMGDDFYAATYDEKTGAITAKTTTYTDGTGVAQTGAVKFGGANGKSEVVTATDGKTYL	76	Protein	Natural	Flagellin and LPS stimulate the production of CXCL1 and CXCL2	Nod-like receptor C4 (NLRC4)	NOD-like receptor (NLR)	Human	medullary collecting duct (MCD) cells	intracellular receptors	Q9NPP4.fasta	Q9NPP4	1024	assemble in an inflammasome complex to activate caspase-1 and promote the release of IL-1Œ≤ and IL-18	ELISA, adhesion and invasion assay	24779433	2014	Pubchem_assay
PRRID_1382	internalized flagellin Click for more detail	Salmonella typhimurium or Legionella pneumophila (Bacteria)	KLSFEDKNGKVIDGGYAVKMGDDFYAATYDEKTGAITAKTTTYTDGTGVAQTGAVKFGGANGKSEVVTATDGKTYL	76	Protein	Natural	Flagellin and LPS stimulate the production of CXCL1 and CXCL2	Nod-like receptor C4 (NLRC4)	NOD-like receptor (NLR)	Human	medullary collecting duct (MCD) cells	intracellular receptors	Q9NPP4.fasta	Q9NPP4	1024	assemble in an inflammasome complex to activate caspase-1 and promote the release of IL-1Œ≤ and IL-18	ELISA, adhesion and invasion assay	24779433	2014	Pubchem_assay
PRRID_1386	L-ornithine muramyl tripeptide Click for more detail	Gram-positive bacteria and some Gram-negative spirochaetes.	CCCCCCCCCCCCCCCC(=O)OC[C@H](COP(=O)(O)OCCNC(=O)[C@H](C)NC(=O)CC[C@@H](NC(=O)[C@H](C)NC(=O)[C@@H](C)O[C@@H]([C@H](O)[C@H](O)CO)[C@@H](NC(=O)C)C=O)C(=O)N)OC(=O)CCCCCCCCCCCCCCC	NA	Peptide	Natural	in vitro activates Nod	Nucleotide Binding Oligomerization Domain Containing 2 (Nod2)	NOD-like receptor (NLR)	Mice	immune cells like peripheral blood monocytes, granulocytes and dendritic cells, as well as in astrocytes of the brain and in paneth cells of the gut	intracellular receptors	Q8K3Z0.fasta	Q8K3Z0	1020	Nod2, are associ- ated with inflammatory bowel disease in humans	NA	24779390	2014	Pubchem_assay
PRRID_1386	L-ornithine muramyl tripeptide Click for more detail	Gram-positive bacteria and some Gram-negative spirochaetes.	CCCCCCCCCCCCCCCC(=O)OC[C@H](COP(=O)(O)OCCNC(=O)[C@H](C)NC(=O)CC[C@@H](NC(=O)[C@H](C)NC(=O)[C@@H](C)O[C@@H]([C@H](O)[C@H](O)CO)[C@@H](NC(=O)C)C=O)C(=O)N)OC(=O)CCCCCCCCCCCCCCC	NA	Peptide	Natural	in vitro activates Nod	Nucleotide Binding Oligomerization Domain Containing 2 (Nod2)	NOD-like receptor (NLR)	Mice	immune cells like peripheral blood monocytes, granulocytes and dendritic cells, as well as in astrocytes of the brain and in paneth cells of the gut	intracellular receptors	Q8K3Z0.fasta	Q8K3Z0	1020	Nod2, are associ- ated with inflammatory bowel disease in humans	NA	24779390	2014	Pubchem_assay
PRRID_1387	L-ornithine muramyl tripeptide Click for more detail	Gram-positive bacteria and some Gram-negative spirochaetes.	CCCCCCCCCCCCCCCC(=O)OC[C@H](COP(=O)(O)OCCNC(=O)[C@H](C)NC(=O)CC[C@@H](NC(=O)[C@H](C)NC(=O)[C@@H](C)O[C@@H]([C@H](O)[C@H](O)CO)[C@@H](NC(=O)C)C=O)C(=O)N)OC(=O)CCCCCCCCCCCCCCC	NA	Peptide	Natural	in vitro activates Nod	Nucleotide Binding Oligomerization Domain Containing 2 (Nod2)	NOD-like receptor (NLR)	Human	immune cells like peripheral blood monocytes, granulocytes and dendritic cells, as well as in astrocytes of the brain and in paneth cells of the gut	intracellular receptors	Q9HC29.fasta	Q9HC29	1040	Nod2, are associ- ated with inflammatory bowel disease in humans	NA	24779390	2014	Pubchem_assay
PRRID_1387	L-ornithine muramyl tripeptide Click for more detail	Gram-positive bacteria and some Gram-negative spirochaetes.	CCCCCCCCCCCCCCCC(=O)OC[C@H](COP(=O)(O)OCCNC(=O)[C@H](C)NC(=O)CC[C@@H](NC(=O)[C@H](C)NC(=O)[C@@H](C)O[C@@H]([C@H](O)[C@H](O)CO)[C@@H](NC(=O)C)C=O)C(=O)N)OC(=O)CCCCCCCCCCCCCCC	NA	Peptide	Natural	in vitro activates Nod	Nucleotide Binding Oligomerization Domain Containing 2 (Nod2)	NOD-like receptor (NLR)	Human	immune cells like peripheral blood monocytes, granulocytes and dendritic cells, as well as in astrocytes of the brain and in paneth cells of the gut	intracellular receptors	Q9HC29.fasta	Q9HC29	1040	Nod2, are associ- ated with inflammatory bowel disease in humans	NA	24779390	2014	Pubchem_assay
PRRID_1472	LRR Click for more detail	Bacteria	NA	NA	Protein	Natural	NA	DUOX2	NOD-like receptor (NLR)	NA	NA	NA	NA	NA	NA	NA	NA	25520185	2014	NA
PRRID_1472	LRR Click for more detail	Bacteria	NA	NA	Protein	Natural	NA	DUOX2	NOD-like receptor (NLR)	NA	NA	NA	NA	NA	NA	NA	NA	25520185	2014	NA
PRRID_1473	LRR Click for more detail	Bacteria	NA	NA	Protein	Natural	NA	FRMPD2	NOD-like receptor (NLR)	NA	stabilizes NOD2, required for NF-kB signalling	NA	NA	NA	NA	NA	NA	25520185	2014	NA
PRRID_1473	LRR Click for more detail	Bacteria	NA	NA	Protein	Natural	NA	FRMPD2	NOD-like receptor (NLR)	NA	stabilizes NOD2, required for NF-kB signalling	NA	NA	NA	NA	NA	NA	25520185	2014	NA
PRRID_1483	meso-diaminopomelic acid (meso- DAP) Click for more detail	Gram-negative bacteria and several Gram-positive bacteria such as Listeria and Bacillus spp	C(CC(C(=O)O)N)CC(C(=O)O)N	NA	Peptide	Natural	in vitro activates Nod1	Nucleotide Binding Oligomerization Domain Containing 1 (Nod1)	NOD-like receptor (NLR)	Human	macrophages and mesothelial cells	serine/threonine RIP2 (RICK, CARDIAK) kinase	Q9Y239.fasta	Q9Y239	953	Nod1 ligation also leads to the activation of NF-jB and MAPKs in neutrophils	ELISA	24766550	2014	Pubchem_assay
PRRID_1483	meso-diaminopomelic acid (meso- DAP) Click for more detail	Gram-negative bacteria and several Gram-positive bacteria such as Listeria and Bacillus spp	C(CC(C(=O)O)N)CC(C(=O)O)N	NA	Peptide	Natural	in vitro activates Nod1	Nucleotide Binding Oligomerization Domain Containing 1 (Nod1)	NOD-like receptor (NLR)	Human	macrophages and mesothelial cells	serine/threonine RIP2 (RICK, CARDIAK) kinase	Q9Y239.fasta	Q9Y239	953	Nod1 ligation also leads to the activation of NF-jB and MAPKs in neutrophils	ELISA	24766550	2014	Pubchem_assay
PRRID_1484	meso-lanthionine tripeptide Click for more detail	PGN of the anaerobic bacterium Fusobacterium nucleatum (Bacteria)	NA	NA	Peptide	Natural	in vitro activates Nod	Nucleotide Binding Oligomerization Domain Containing 1 (Nod1)	NOD-like receptor (NLR)	Mice	most adult tissues	intracellular receptors	Q8BHB0.fasta	Q8BHB0	953	play key roles in regulation of innate immune response. NLRs can cooperate with Toll-like receptors and regulate inflammatory and apoptotic response.	NA	24779390	2014	Pubchem_assay
PRRID_1484	meso-lanthionine tripeptide Click for more detail	PGN of the anaerobic bacterium Fusobacterium nucleatum (Bacteria)	NA	NA	Peptide	Natural	in vitro activates Nod	Nucleotide Binding Oligomerization Domain Containing 1 (Nod1)	NOD-like receptor (NLR)	Mice	most adult tissues	intracellular receptors	Q8BHB0.fasta	Q8BHB0	953	play key roles in regulation of innate immune response. NLRs can cooperate with Toll-like receptors and regulate inflammatory and apoptotic response.	NA	24779390	2014	Pubchem_assay
PRRID_1485	meso-lanthionine tripeptide Click for more detail	PGN of the anaerobic bacterium Fusobacterium nucleatum (Bacteria)	NA	NA	Peptide	Natural	in vitro activates Nod	Nucleotide Binding Oligomerization Domain Containing 1 (Nod1)	NOD-like receptor (NLR)	Human	most adult tissues	intracellular receptors	Q9Y239.fasta	Q9Y239	953	play key roles in regulation of innate immune response. NLRs can cooperate with Toll-like receptors and regulate inflammatory and apoptotic response.	NA	24779390	2014	Pubchem_assay
PRRID_1485	meso-lanthionine tripeptide Click for more detail	PGN of the anaerobic bacterium Fusobacterium nucleatum (Bacteria)	NA	NA	Peptide	Natural	in vitro activates Nod	Nucleotide Binding Oligomerization Domain Containing 1 (Nod1)	NOD-like receptor (NLR)	Human	most adult tissues	intracellular receptors	Q9Y239.fasta	Q9Y239	953	play key roles in regulation of innate immune response. NLRs can cooperate with Toll-like receptors and regulate inflammatory and apoptotic response.	NA	24779390	2014	Pubchem_assay
PRRID_1489	mRNA Click for more detail	RNA virus (Virus)	NA	NA	Nucleic Acid	Natural	triggers immune responses	Nucleotide Binding Oligomerization Domain Containing 2 (Nod2)	NOD-like receptor (NLR)	Mice	Dendritic Cell, B-lymphocyte	cell compartment	Q8K3Z0.fasta	Q8K3Z0	1020	Possible effect in case of stroke i.e it is Involved in preconditioning and No protection after gene knockout following cerebral ischemia	NA	24807166	2014	Pubchem_assay
PRRID_1489	mRNA Click for more detail	RNA virus (Virus)	NA	NA	Nucleic Acid	Natural	triggers immune responses	Nucleotide Binding Oligomerization Domain Containing 2 (Nod2)	NOD-like receptor (NLR)	Mice	Dendritic Cell, B-lymphocyte	cell compartment	Q8K3Z0.fasta	Q8K3Z0	1020	Possible effect in case of stroke i.e it is Involved in preconditioning and No protection after gene knockout following cerebral ischemia	NA	24807166	2014	Pubchem_assay
PRRID_1491	muramyl dipeptide (MDP) Click for more detail	Gram-positive and negative bacteria	CC(C(=O)NC(CCC(=O)O)C(=O)N)NC(=O)C(C)OC1C(C(OC(C1O)CO)O)NC(=O)C	NA	Peptide	Natural	leads to cytokine activation, especially IL-1Œ± and IL-1Œ≤.	Nucleotide Binding Oligomerization Domain Containing 2 (Nod2)	NOD-like receptor (NLR)	Human	peripheral blood mononuclear cells such as macrophages, granulocytes, dendritic cells, and along the intestinal epithelial cells	intracellular receptors	Q9HC29.fasta	Q9HC29	1040	recognizes fragments of the bacterial cell wall.	Luciferase assay	24790089	2014	Pubchem_assay
PRRID_1491	muramyl dipeptide (MDP) Click for more detail	Gram-positive and negative bacteria	CC(C(=O)NC(CCC(=O)O)C(=O)N)NC(=O)C(C)OC1C(C(OC(C1O)CO)O)NC(=O)C	NA	Peptide	Natural	leads to cytokine activation, especially IL-1Œ± and IL-1Œ≤.	Nucleotide Binding Oligomerization Domain Containing 2 (Nod2)	NOD-like receptor (NLR)	Human	peripheral blood mononuclear cells such as macrophages, granulocytes, dendritic cells, and along the intestinal epithelial cells	intracellular receptors	Q9HC29.fasta	Q9HC29	1040	recognizes fragments of the bacterial cell wall.	Luciferase assay	24790089	2014	Pubchem_assay
PRRID_1492	muramyl dipeptide (MDP) Click for more detail	Gram-positive and negative bacteria	CC(C(=O)NC(CCC(=O)O)C(=O)N)NC(=O)C(C)OC1C(C(OC(C1O)CO)O)NC(=O)C	NA	Peptidoglycan	Natural	leads to cytokine activation, especially IL-1Œ± and IL-1Œ≤.	Nucleotide Binding Oligomerization Domain Containing 2 (Nod2)	NOD-like receptor (NLR)	Human	peripheral mononuclear cells and monocyte-derived dendritic cells (Mo-DCs) from CD pateints	intracellular receptors	Q9HC29.fasta	Q9HC29	1040	Innate immune responses mediated by NOD2, including production of pro-inflammatory cytokines and antimicrobial peptides, as well as induction of autophagy, are thought to have a central role in the pathogenesis of CD and these processes are impaired in patients homozygous for NOD2 mutations	ELISA	24781050	2014	Pubchem_assay
PRRID_1492	muramyl dipeptide (MDP) Click for more detail	Gram-positive and negative bacteria	CC(C(=O)NC(CCC(=O)O)C(=O)N)NC(=O)C(C)OC1C(C(OC(C1O)CO)O)NC(=O)C	NA	Peptidoglycan	Natural	leads to cytokine activation, especially IL-1Œ± and IL-1Œ≤.	Nucleotide Binding Oligomerization Domain Containing 2 (Nod2)	NOD-like receptor (NLR)	Human	peripheral mononuclear cells and monocyte-derived dendritic cells (Mo-DCs) from CD pateints	intracellular receptors	Q9HC29.fasta	Q9HC29	1040	Innate immune responses mediated by NOD2, including production of pro-inflammatory cytokines and antimicrobial peptides, as well as induction of autophagy, are thought to have a central role in the pathogenesis of CD and these processes are impaired in patients homozygous for NOD2 mutations	ELISA	24781050	2014	Pubchem_assay
PRRID_1493	muramyl dipeptide (MDP) Click for more detail	Gram-negative and Gram-positive bacteria	CC(C(=O)NC(CCC(=O)O)C(=O)N)NC(=O)C(C)OC1C(C(OC(C1O)CO)O)NC(=O)C	NA	Peptide	Natural	induces interleu- kin-8 (IL-8) production, CD62 ligand shedding, and CD11b up-regulation	Nucleotide Binding Oligomerization Domain Containing 2 (Nod2)	NOD-like receptor (NLR)	Mice	Neutrophils	serine/threonine RIP2 (RICK, CARDIAK) kinase	Q8K3Z0.fasta	Q8K3Z0	1020	involved in neutrophil immune responses in response to bacterial infection.	ELISA	24766550	2014	Pubchem_assay
PRRID_1493	muramyl dipeptide (MDP) Click for more detail	Gram-negative and Gram-positive bacteria	CC(C(=O)NC(CCC(=O)O)C(=O)N)NC(=O)C(C)OC1C(C(OC(C1O)CO)O)NC(=O)C	NA	Peptide	Natural	induces interleu- kin-8 (IL-8) production, CD62 ligand shedding, and CD11b up-regulation	Nucleotide Binding Oligomerization Domain Containing 2 (Nod2)	NOD-like receptor (NLR)	Mice	Neutrophils	serine/threonine RIP2 (RICK, CARDIAK) kinase	Q8K3Z0.fasta	Q8K3Z0	1020	involved in neutrophil immune responses in response to bacterial infection.	ELISA	24766550	2014	Pubchem_assay
PRRID_1494	muramyl dipeptide (MDP) Click for more detail	Gram-negative and Gram-positive bacteria	CC(C(=O)NC(CCC(=O)O)C(=O)N)NC(=O)C(C)OC1C(C(OC(C1O)CO)O)NC(=O)C	NA	Peptide	Natural	induces interleu- kin-8 (IL-8) production, CD62 ligand shedding, and CD11b up-regulation	Nucleotide Binding Oligomerization Domain Containing 2 (Nod2)	NOD-like receptor (NLR)	Human	Neutrophils	serine/threonine RIP2 (RICK, CARDIAK) kinase	Q8K3Z0.fasta	Q8K3Z0	1020	involved in neutrophil immune responses in response to bacterial infection.	ELISA	24766550	2014	Pubchem_assay
PRRID_1494	muramyl dipeptide (MDP) Click for more detail	Gram-negative and Gram-positive bacteria	CC(C(=O)NC(CCC(=O)O)C(=O)N)NC(=O)C(C)OC1C(C(OC(C1O)CO)O)NC(=O)C	NA	Peptide	Natural	induces interleu- kin-8 (IL-8) production, CD62 ligand shedding, and CD11b up-regulation	Nucleotide Binding Oligomerization Domain Containing 2 (Nod2)	NOD-like receptor (NLR)	Human	Neutrophils	serine/threonine RIP2 (RICK, CARDIAK) kinase	Q8K3Z0.fasta	Q8K3Z0	1020	involved in neutrophil immune responses in response to bacterial infection.	ELISA	24766550	2014	Pubchem_assay
PRRID_1497	N-glycolylated muramic acid Click for more detail	Mycobacterium smegmatis and Mycobacterium tuberculosis (Bacteria)	CC(C(=O)O)OC1C(C(OC(C1O)CO)O)NC(=O)C	NA	Carbohydrate	Natural	activates NOD2	Nod-like receptor 1 (NLR1)	NOD-like receptor (NLR)	Mice	immune cells like peripheral blood monocytes, granulocytes and dendritic cells, as well as in astrocytes of the brain and in paneth cells of the gut	intracellular receptors	Q8K3Z0.fasta	Q8K3Z0	1020	Nod2, are associ- ated with inflammatory bowel disease in humans	NA	24779390	2014	Pubchem_assay
PRRID_1497	N-glycolylated muramic acid Click for more detail	Mycobacterium smegmatis and Mycobacterium tuberculosis (Bacteria)	CC(C(=O)O)OC1C(C(OC(C1O)CO)O)NC(=O)C	NA	Carbohydrate	Natural	activates NOD2	Nod-like receptor 1 (NLR1)	NOD-like receptor (NLR)	Mice	immune cells like peripheral blood monocytes, granulocytes and dendritic cells, as well as in astrocytes of the brain and in paneth cells of the gut	intracellular receptors	Q8K3Z0.fasta	Q8K3Z0	1020	Nod2, are associ- ated with inflammatory bowel disease in humans	NA	24779390	2014	Pubchem_assay
PRRID_1498	N-glycolylated muramic acid Click for more detail	Mycobacterium smegmatis and Mycobacterium tuberculosis (Bacteria)	CC(C(=O)O)OC1C(C(OC(C1O)CO)O)NC(=O)C	NA	Carbohydrate	Natural	activates NOD2	Nod-like receptor 1 (NLR1)	NOD-like receptor (NLR)	Human	immune cells like peripheral blood monocytes, granulocytes and dendritic cells, as well as in astrocytes of the brain and in paneth cells of the gut	intracellular receptors	Q9HC29.fasta	Q9HC29	1040	Nod2, are associ- ated with inflammatory bowel disease in humans	NA	24779390	2014	Pubchem_assay
PRRID_1498	N-glycolylated muramic acid Click for more detail	Mycobacterium smegmatis and Mycobacterium tuberculosis (Bacteria)	CC(C(=O)O)OC1C(C(OC(C1O)CO)O)NC(=O)C	NA	Carbohydrate	Natural	activates NOD2	Nod-like receptor 1 (NLR1)	NOD-like receptor (NLR)	Human	immune cells like peripheral blood monocytes, granulocytes and dendritic cells, as well as in astrocytes of the brain and in paneth cells of the gut	intracellular receptors	Q9HC29.fasta	Q9HC29	1040	Nod2, are associ- ated with inflammatory bowel disease in humans	NA	24779390	2014	Pubchem_assay
PRRID_1504	NACHT Click for more detail	Bacteria	NA	NA	Protein	Natural	NA	CARD8	NOD-like receptor (NLR)	NA	NA	NA	NA	NA	NA	NA	NA	25520185	2014	NA
PRRID_1504	NACHT Click for more detail	Bacteria	NA	NA	Protein	Natural	NA	CARD8	NOD-like receptor (NLR)	NA	NA	NA	NA	NA	NA	NA	NA	25520185	2014	NA
PRRID_1505	NACHT Click for more detail	Bacteria	NA	NA	Protein	Natural	NA	Nod-like receptor C4 (NLRC4)	NOD-like receptor (NLR)	NA	NA	NA	NA	NA	NA	NA	NA	25520185	2014	NA
PRRID_1505	NACHT Click for more detail	Bacteria	NA	NA	Protein	Natural	NA	Nod-like receptor C4 (NLRC4)	NOD-like receptor (NLR)	NA	NA	NA	NA	NA	NA	NA	NA	25520185	2014	NA
PRRID_1506	NACHT Click for more detail	Bacteria	NA	NA	Protein	Natural	NA	TRIM27	NOD-like receptor (NLR)	NA	NA	NA	NA	NA	NA	NA	NA	25520185	2014	NA
PRRID_1506	NACHT Click for more detail	Bacteria	NA	NA	Protein	Natural	NA	TRIM27	NOD-like receptor (NLR)	NA	NA	NA	NA	NA	NA	NA	NA	25520185	2014	NA
PRRID_1507	NACHT-LRR Click for more detail	Bacteria	NA	NA	Protein	Natural	NA	MAVS	NOD-like receptor (NLR)	NA	NA	NA	NA	NA	NA	NA	NA	25520185	2014	NA
PRRID_1507	NACHT-LRR Click for more detail	Bacteria	NA	NA	Protein	Natural	NA	MAVS	NOD-like receptor (NLR)	NA	NA	NA	NA	NA	NA	NA	NA	25520185	2014	NA
PRRID_1508	NACHT-LRR Click for more detail	Virus	NA	NA	Protein	Natural	NA	NIK	NOD-like receptor (NLR)	NA	antiviral defence	NA	NA	NA	NA	NA	NA	25520185	2014	NA
PRRID_1508	NACHT-LRR Click for more detail	Virus	NA	NA	Protein	Natural	NA	NIK	NOD-like receptor (NLR)	NA	antiviral defence	NA	NA	NA	NA	NA	NA	25520185	2014	NA

previous 123 4 5 6 7 8 9 10 next