Browse result page of PRRDB 2.0
| PRRID | Name of Ligand | Source of ligand | Sequence of Ligand | Length of Ligand | Type of Ligand | Occurence | Role of Ligand | Name of Receptor | Type of Reeptor | Source of the Receptor | Localization | Domain | Sequence of Receptor | Swiss prot ID | Length of receptor | Function of Receptor | Assay used | PMID | Year of publication | Pubchem assay |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| PRRID_0815 | T4SS Click for more detail | Gram-negative bacteria | NA | NA | Protein | Natural | It activates caspase 1 dependent IL-1β and IL-18 secretion in response. | Nod-like receptor C4 (NLRC4) | NOD-like receptor (NLR) | NA | NA | NA | NA | NA | NA | It act as VAMPs, which results into the clearance of the pathogen due to the activation of the immune systems | NA | 20349122 | 2010 | NA |
| PRRID_0815 | T4SS Click for more detail | Gram-negative bacteria | NA | NA | Protein | Natural | It activates caspase 1 dependent IL-1β and IL-18 secretion in response. | Nod-like receptor C4 (NLRC4) | NOD-like receptor (NLR) | NA | NA | NA | NA | NA | NA | It act as VAMPs, which results into the clearance of the pathogen due to the activation of the immune systems | NA | 20349122 | 2010 | NA |
| PRRID_0823 | type III or IV secretion systems Click for more detail | Salmonella typhimurium, Shigella flexneri, Legionella pneumophila and Pseudomonas aeruginosa (Bacter | NA | NA | Protein | Natural | It’s binding to the NLRP1 leads to the activation of caspase-1, | IPAF | NOD-like receptor (NLR) | NA | NA | NA | NA | NA | NA | IPAF-dependent caspase-1 activation is accompanied by rapid cell death | ELISA | 20133635 | 2010 | NA |
| PRRID_0823 | type III or IV secretion systems Click for more detail | Salmonella typhimurium, Shigella flexneri, Legionella pneumophila and Pseudomonas aeruginosa (Bacter | NA | NA | Protein | Natural | It’s binding to the NLRP1 leads to the activation of caspase-1, | IPAF | NOD-like receptor (NLR) | NA | NA | NA | NA | NA | NA | IPAF-dependent caspase-1 activation is accompanied by rapid cell death | ELISA | 20133635 | 2010 | NA |
| PRRID_0868 | alum (aluminium adjuvants ) Click for more detail | NA | O.O.O.O.O.O.O.O.O.O.O.O.[O-]S(=O)(=O)[O-].[O-]S(=O)(=O)[O-].[Al+3].[K+] | NA | NA | Synthetic | NA | Nucleotide-binding oligomerization domain, Leucine rich Repeat and Pyrin domain containing3 (Nalp3) | NOD-like receptor (NLR) | Human | Eosinophils | NA | Q96P20.fasta | Q96P20 | 1036 | NLRP3 responds to microbial products and host-derived danger signals and activates the caspase-1- dependent inflammasome | real-time reverse transcription-PCR, FACS, ELISA | 21978001 | 2011 | Pubchem Assay |
| PRRID_0868 | alum (aluminium adjuvants ) Click for more detail | NA | O.O.O.O.O.O.O.O.O.O.O.O.[O-]S(=O)(=O)[O-].[O-]S(=O)(=O)[O-].[Al+3].[K+] | NA | NA | Synthetic | NA | Nucleotide-binding oligomerization domain, Leucine rich Repeat and Pyrin domain containing3 (Nalp3) | NOD-like receptor (NLR) | Human | Eosinophils | NA | Q96P20.fasta | Q96P20 | 1036 | NLRP3 responds to microbial products and host-derived danger signals and activates the caspase-1- dependent inflammasome | real-time reverse transcription-PCR, FACS, ELISA | 21978001 | 2011 | Pubchem Assay |
| PRRID_0869 | alum (aluminium adjuvants ) Click for more detail | NA | O.O.O.O.O.O.O.O.O.O.O.O.[O-]S(=O)(=O)[O-].[O-]S(=O)(=O)[O-].[Al+3].[K+] | NA | NA | Synthetic | NA | Nucleotide-binding oligomerization domain, Leucine rich Repeat and Pyrin domain containing3 (Nalp3) | NOD-like receptor (NLR) | Balb/c mice | Spleen and lung | NA | Q8R4B8.fasta | Q8R4B8 | 1033 | NLRP3 responds to microbial products and host-derived danger signals and activates the caspase-1- dependent inflammasome | ELISA | 21963872 | 2011 | Pubchem Assay |
| PRRID_0869 | alum (aluminium adjuvants ) Click for more detail | NA | O.O.O.O.O.O.O.O.O.O.O.O.[O-]S(=O)(=O)[O-].[O-]S(=O)(=O)[O-].[Al+3].[K+] | NA | NA | Synthetic | NA | Nucleotide-binding oligomerization domain, Leucine rich Repeat and Pyrin domain containing3 (Nalp3) | NOD-like receptor (NLR) | Balb/c mice | Spleen and lung | NA | Q8R4B8.fasta | Q8R4B8 | 1033 | NLRP3 responds to microbial products and host-derived danger signals and activates the caspase-1- dependent inflammasome | ELISA | 21963872 | 2011 | Pubchem Assay |
| PRRID_0911 | iE-DAP (gamma-D-glutamyl-meso diaminopimelic acid) Click for more detail | Bacteria | N[C@@H](CCC[C@@H](NC(=O)CC[C@@H](N)C(O)=O)C(O)=O)C(O)=O | NA | Pattern-associated molecular patterns (PAMPs) | Natural | peptidoglycan substructures | Nucleotide Binding Oligomerization Domain Containing 1 (Nod1) | NOD-like receptor (NLR) | Human | Eosinophils | NA | Q9Y239.fasta | Q9Y239 | 953 | play key roles in regulation of innate immune response. NLRs can cooperate with Toll-like receptors and regulate inflammatory and apoptotic response. | real-time reverse transcription-PCR, FACS, ELISA | 21978001 | 2011 | Pubchem Assay |
| PRRID_0911 | iE-DAP (gamma-D-glutamyl-meso diaminopimelic acid) Click for more detail | Bacteria | N[C@@H](CCC[C@@H](NC(=O)CC[C@@H](N)C(O)=O)C(O)=O)C(O)=O | NA | Pattern-associated molecular patterns (PAMPs) | Natural | peptidoglycan substructures | Nucleotide Binding Oligomerization Domain Containing 1 (Nod1) | NOD-like receptor (NLR) | Human | Eosinophils | NA | Q9Y239.fasta | Q9Y239 | 953 | play key roles in regulation of innate immune response. NLRs can cooperate with Toll-like receptors and regulate inflammatory and apoptotic response. | real-time reverse transcription-PCR, FACS, ELISA | 21978001 | 2011 | Pubchem Assay |
| PRRID_0935 | MDP (muramyldipeptide) Click for more detail | Gram-negative and Gram-positive bacteria | CC(C(=O)NC(CCC(=O)O)C(=O)N)NC(=O)C(C)OC1C(C(OC(C1O)CO)O)NC(=O)C | NA | Peptide | Natural | leads to cytokine activation, especially IL-1α and IL-1β. | Nucleotide-binding oligomerization domain, Leucine rich Repeat and Pyrin domain containing3 (Nalp3) | NOD-like receptor (NLR) | Human | Eosinophils | NA | Q96P20.fasta | Q96P20 | 1036 | recognizes fragments of the bacterial cell wall | real-time reverse transcription-PCR, FACS, ELISA | 21978001 | 2011 | Pubchem Assay |
| PRRID_0935 | MDP (muramyldipeptide) Click for more detail | Gram-negative and Gram-positive bacteria | CC(C(=O)NC(CCC(=O)O)C(=O)N)NC(=O)C(C)OC1C(C(OC(C1O)CO)O)NC(=O)C | NA | Peptide | Natural | leads to cytokine activation, especially IL-1α and IL-1β. | Nucleotide-binding oligomerization domain, Leucine rich Repeat and Pyrin domain containing3 (Nalp3) | NOD-like receptor (NLR) | Human | Eosinophils | NA | Q96P20.fasta | Q96P20 | 1036 | recognizes fragments of the bacterial cell wall | real-time reverse transcription-PCR, FACS, ELISA | 21978001 | 2011 | Pubchem Assay |
| PRRID_0939 | Paclitaxel Click for more detail | Pacific yew (plant) | C1=C2C(C(=O)C3(C(CC4C(C3C(C(C2(C)C)(CC1OC(=O)C(C(C5=CC=CC=C5)NC(=O)C6=CC=CC=C6)O)O)OC(=O)C7=CC=CC=C7)(CO4)OC(=O)C)O)C)OC(=O)C | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | used to treat a number of types of cancer | Nucleotide Binding Oligomerization Domain Containing 2 (Nod2) | NOD-like receptor (NLR) | Human | Myeloid cells, microglia, astrocytes, neurons | NA | Q9HC29.fasta | Q9HC29 | 1040 | TLR 4 leads to an intracellular signaling pathway NF-κB and inflammatory cytokine production which is responsible for activating the innate immune system | NA | 21982558 | 2011 | Pubchem Assay |
| PRRID_0939 | Paclitaxel Click for more detail | Pacific yew (plant) | C1=C2C(C(=O)C3(C(CC4C(C3C(C(C2(C)C)(CC1OC(=O)C(C(C5=CC=CC=C5)NC(=O)C6=CC=CC=C6)O)O)OC(=O)C7=CC=CC=C7)(CO4)OC(=O)C)O)C)OC(=O)C | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | used to treat a number of types of cancer | Nucleotide Binding Oligomerization Domain Containing 2 (Nod2) | NOD-like receptor (NLR) | Human | Myeloid cells, microglia, astrocytes, neurons | NA | Q9HC29.fasta | Q9HC29 | 1040 | TLR 4 leads to an intracellular signaling pathway NF-κB and inflammatory cytokine production which is responsible for activating the innate immune system | NA | 21982558 | 2011 | Pubchem Assay |
| PRRID_0977 | ATP Click for more detail | NA | C1=NC2=C(C(=N1)N)N=CN2C3C(C(C(O3)COP(=O)(O)OP(=O)(O)OP(=O)(O)O)O)O | NA | Small molecule | Natural | immunostimulant | Nucleotide Binding Oligomerization Domain Containing 2 (Nod2) | NOD-like receptor (NLR) | Human | PBMCs | NA | Q9HC29.fasta | Q9HC29 | 1040 | induction of IL-6 and IL-8 | ELISA | 22998942 | 2012 | Pubchem Assay |
| PRRID_0977 | ATP Click for more detail | NA | C1=NC2=C(C(=N1)N)N=CN2C3C(C(C(O3)COP(=O)(O)OP(=O)(O)OP(=O)(O)O)O)O | NA | Small molecule | Natural | immunostimulant | Nucleotide Binding Oligomerization Domain Containing 2 (Nod2) | NOD-like receptor (NLR) | Human | PBMCs | NA | Q9HC29.fasta | Q9HC29 | 1040 | induction of IL-6 and IL-8 | ELISA | 22998942 | 2012 | Pubchem Assay |
| PRRID_1004 | Mitochondrial DNA Click for more detail | NA | NA | NA | NA | Natural | Immunostimulant | Nod-like receptor P3 (NLRP3) | NOD-like receptor (NLR) | NA | NA | NA | NA | NA | NA | TLR9 antagonists | NA | 22998942 | 2012 | NA |
| PRRID_1004 | Mitochondrial DNA Click for more detail | NA | NA | NA | NA | Natural | Immunostimulant | Nod-like receptor P3 (NLRP3) | NOD-like receptor (NLR) | NA | NA | NA | NA | NA | NA | TLR9 antagonists | NA | 22998942 | 2012 | NA |
| PRRID_1021 | ATP Click for more detail | NA | C1=NC2=C(C(=N1)N)N=CN2C3C(C(C(O3)COP(=O)(O)OP(=O)(O)OP(=O)(O)O)O)O | NA | Damage-associated molecular patterns (DAMPs) | Natural | triggers immune responses | Nod-like receptor protein 3 (P2X7R) (NLRP3 (P2X7R) | NOD-like receptor (NLR) | Mice | graft-versus-host disease (GVHD) | NA | Q8BHB0.fasta | Q8BHB0 | 953 | Blockade of ATP-P2X7R signaling pathways decreased acute GVHD | NA | 23985302 | 2013 | Pubchem Assay |
| PRRID_1021 | ATP Click for more detail | NA | C1=NC2=C(C(=N1)N)N=CN2C3C(C(C(O3)COP(=O)(O)OP(=O)(O)OP(=O)(O)O)O)O | NA | Damage-associated molecular patterns (DAMPs) | Natural | triggers immune responses | Nod-like receptor protein 3 (P2X7R) (NLRP3 (P2X7R) | NOD-like receptor (NLR) | Mice | graft-versus-host disease (GVHD) | NA | Q8BHB0.fasta | Q8BHB0 | 953 | Blockade of ATP-P2X7R signaling pathways decreased acute GVHD | NA | 23985302 | 2013 | Pubchem Assay |
| PRRID_1022 | ATP Click for more detail | NA | C1=NC2=C(C(=N1)N)N=CN2C3C(C(C(O3)COP(=O)(O)OP(=O)(O)OP(=O)(O)O)O)O | NA | Damage-associated molecular patterns (DAMPs) | Natural | triggers immune responses | Nod-like receptor protein 3 (P2X7R) (NLRP3 (P2X7R) | NOD-like receptor (NLR) | Human | graft-versus-host disease (GVHD) | NA | Q96P20.fasta | Q96P20 | 1036 | Polymorphisms of P2X7R, NALP2 and NALP3 are associated with OS | NA | 23985302 | 2013 | Pubchem Assay |
| PRRID_1022 | ATP Click for more detail | NA | C1=NC2=C(C(=N1)N)N=CN2C3C(C(C(O3)COP(=O)(O)OP(=O)(O)OP(=O)(O)O)O)O | NA | Damage-associated molecular patterns (DAMPs) | Natural | triggers immune responses | Nod-like receptor protein 3 (P2X7R) (NLRP3 (P2X7R) | NOD-like receptor (NLR) | Human | graft-versus-host disease (GVHD) | NA | Q96P20.fasta | Q96P20 | 1036 | Polymorphisms of P2X7R, NALP2 and NALP3 are associated with OS | NA | 23985302 | 2013 | Pubchem Assay |
| PRRID_1110 | muramyl dipeptide (MDP) Click for more detail | Gram-positive and negative bacteria | CC(C(=O)NC(CCC(=O)O)C(=O)N)NC(=O)C(C)OC1C(C(OC(C1O)CO)O)NC(=O)C | NA | Peptide | Natural | a component of bacterial peptidoglycan, and induces NF-jB activation, leading to enhanced Th1 responses | Nucleotide Binding Oligomerization Domain Containing 2 (Nod2) | NOD-like receptor (NLR) | Mice | graft-versus-host disease (GVHD) | NA | Q8K3Z0.fasta | Q8K3Z0 | 1020 | NOD2 functions as a primary sensor of microbial products inducing inflammatory T-cell responses and also negatively regulates TLR-mediated responses | NA | 23985302 | 2013 | Pubchem_assay |
| PRRID_1110 | muramyl dipeptide (MDP) Click for more detail | Gram-positive and negative bacteria | CC(C(=O)NC(CCC(=O)O)C(=O)N)NC(=O)C(C)OC1C(C(OC(C1O)CO)O)NC(=O)C | NA | Peptide | Natural | a component of bacterial peptidoglycan, and induces NF-jB activation, leading to enhanced Th1 responses | Nucleotide Binding Oligomerization Domain Containing 2 (Nod2) | NOD-like receptor (NLR) | Mice | graft-versus-host disease (GVHD) | NA | Q8K3Z0.fasta | Q8K3Z0 | 1020 | NOD2 functions as a primary sensor of microbial products inducing inflammatory T-cell responses and also negatively regulates TLR-mediated responses | NA | 23985302 | 2013 | Pubchem_assay |
| PRRID_1130 | muramyl dipeptide (MDP) Click for more detail | Gram-positive and negative bacteria | CC(C(=O)NC(CCC(=O)O)C(=O)N)NC(=O)C(C)OC1C(C(OC(C1O)CO)O)NC(=O)C | NA | Peptide | Natural | a component of bacterial peptidoglycan, and induces NF-jB activation, leading to enhanced Th1 responses | Nod-like receptor protein 3 (P2X7R) (NLRP3 (P2X7R) | NOD-like receptor (NLR) | Human | graft-versus-host disease (GVHD) | NA | Q96P20.fasta | Q96P20 | 1036 | NOD2 functions as a primary sensor of microbial products inducing inflammatory T-cell responses and also negatively regulates TLR-mediated responses | NA | 23985302 | 2013 | Pubchem_assay |
| PRRID_1130 | muramyl dipeptide (MDP) Click for more detail | Gram-positive and negative bacteria | CC(C(=O)NC(CCC(=O)O)C(=O)N)NC(=O)C(C)OC1C(C(OC(C1O)CO)O)NC(=O)C | NA | Peptide | Natural | a component of bacterial peptidoglycan, and induces NF-jB activation, leading to enhanced Th1 responses | Nod-like receptor protein 3 (P2X7R) (NLRP3 (P2X7R) | NOD-like receptor (NLR) | Human | graft-versus-host disease (GVHD) | NA | Q96P20.fasta | Q96P20 | 1036 | NOD2 functions as a primary sensor of microbial products inducing inflammatory T-cell responses and also negatively regulates TLR-mediated responses | NA | 23985302 | 2013 | Pubchem_assay |
| PRRID_1180 | amidation of the mesoDAP Click for more detail | PGN of Gram-positive bacteria | C(CC(C(=O)O)N)CC(C(=O)O)N | NA | Protein | Natural | activates NOD2 but not recognised by NOD2 | Nod-like receptor protein 3 (P2X7R) (NLRP3 (P2X7R) | NOD-like receptor (NLR) | Mice | most adult tissues | intracellular receptors | Q8BHB0.fasta | Q8BHB0 | 953 | play key roles in regulation of innate immune response. NLRs can cooperate with Toll-like receptors and regulate inflammatory and apoptotic response. | NA | 24779390 | 2014 | Pubchem_assay |
| PRRID_1180 | amidation of the mesoDAP Click for more detail | PGN of Gram-positive bacteria | C(CC(C(=O)O)N)CC(C(=O)O)N | NA | Protein | Natural | activates NOD2 but not recognised by NOD2 | Nod-like receptor protein 3 (P2X7R) (NLRP3 (P2X7R) | NOD-like receptor (NLR) | Mice | most adult tissues | intracellular receptors | Q8BHB0.fasta | Q8BHB0 | 953 | play key roles in regulation of innate immune response. NLRs can cooperate with Toll-like receptors and regulate inflammatory and apoptotic response. | NA | 24779390 | 2014 | Pubchem_assay |
| PRRID_1181 | amidation of the mesoDAP Click for more detail | PGN of Gram-positive bacteria | C(CC(C(=O)O)N)CC(C(=O)O)N | NA | Protein | Natural | activates NOD2 but not recognised by NOD2 | CAD | NOD-like receptor (NLR) | Human | most adult tissues | intracellular receptors | Q9Y239.fasta | Q9Y239 | 953 | play key roles in regulation of innate immune response. NLRs can cooperate with Toll-like receptors and regulate inflammatory and apoptotic response. | NA | 24779390 | 2014 | Pubchem_assay |
| PRRID_1181 | amidation of the mesoDAP Click for more detail | PGN of Gram-positive bacteria | C(CC(C(=O)O)N)CC(C(=O)O)N | NA | Protein | Natural | activates NOD2 but not recognised by NOD2 | CAD | NOD-like receptor (NLR) | Human | most adult tissues | intracellular receptors | Q9Y239.fasta | Q9Y239 | 953 | play key roles in regulation of innate immune response. NLRs can cooperate with Toll-like receptors and regulate inflammatory and apoptotic response. | NA | 24779390 | 2014 | Pubchem_assay |
| PRRID_1182 | anti-citrullinated protein antibody-positive (ACPA+) RA. Click for more detail | Present in the majority of patients with Rheumatoid arthritis (others) | NA | NA | NA | Natural | NA | Caspase-1 | NOD-like receptor (NLR) | Human | mast cells | NA | B4DVD8.fasta | B4DVD8 | 301 | contribute to the protective functions of the immune cells | Flow cytometry | 24818634 | 2014 | Pubchem_assay |
| PRRID_1182 | anti-citrullinated protein antibody-positive (ACPA+) RA. Click for more detail | Present in the majority of patients with Rheumatoid arthritis (others) | NA | NA | NA | Natural | NA | Caspase-1 | NOD-like receptor (NLR) | Human | mast cells | NA | B4DVD8.fasta | B4DVD8 | 301 | contribute to the protective functions of the immune cells | Flow cytometry | 24818634 | 2014 | Pubchem_assay |
| PRRID_1184 | bacterial RNA Click for more detail | Bacteria | NA | NA | Nucleic Acid | Natural | elicit innate immune response | Nod-like receptor protein 1 (NLRP1) | NOD-like receptor (NLR) | Human | plasmacytoid and myeloid DCs | extracellular domain (ECD) | Q9NYK1.fasta | Q9NYK1 | 1049 | controlling antiviral host defense or autoimmune diseases and TLR8 and respond to its activation with TNF production and/or degranulation | Microarray analysis, Quantitative PCR, Phosphoproteomic screen, Confocal cell imaging,RNA40 pull-down assay and Immunoblot | 24813206 | 2014 | Pubchem_assay |
| PRRID_1184 | bacterial RNA Click for more detail | Bacteria | NA | NA | Nucleic Acid | Natural | elicit innate immune response | Nod-like receptor protein 1 (NLRP1) | NOD-like receptor (NLR) | Human | plasmacytoid and myeloid DCs | extracellular domain (ECD) | Q9NYK1.fasta | Q9NYK1 | 1049 | controlling antiviral host defense or autoimmune diseases and TLR8 and respond to its activation with TNF production and/or degranulation | Microarray analysis, Quantitative PCR, Phosphoproteomic screen, Confocal cell imaging,RNA40 pull-down assay and Immunoblot | 24813206 | 2014 | Pubchem_assay |
| PRRID_1185 | Viral RNA Click for more detail | Bacteria | NA | NA | Nucleic Acid | Natural | elicit innate immune response | Nod-like receptor P3 (NLRP3) | NOD-like receptor (NLR) | Human | plasmacytoid and myeloid DCs | extracellular domain (ECD) | Q9NYK1.fasta | Q9NYK1 | 1049 | controlling antiviral host defense or autoimmune diseases and TLR8 and respond to its activation with TNF production and/or degranulation | Microarray analysis, Quantitative PCR, Phosphoproteomic screen, Confocal cell imaging,RNA40 pull-down assay and Immunoblot | 24813206 | 2014 | Pubchem_assay |
| PRRID_1185 | Viral RNA Click for more detail | Bacteria | NA | NA | Nucleic Acid | Natural | elicit innate immune response | Nod-like receptor P3 (NLRP3) | NOD-like receptor (NLR) | Human | plasmacytoid and myeloid DCs | extracellular domain (ECD) | Q9NYK1.fasta | Q9NYK1 | 1049 | controlling antiviral host defense or autoimmune diseases and TLR8 and respond to its activation with TNF production and/or degranulation | Microarray analysis, Quantitative PCR, Phosphoproteomic screen, Confocal cell imaging,RNA40 pull-down assay and Immunoblot | 24813206 | 2014 | Pubchem_assay |
| PRRID_1186 | bacterialRNA Click for more detail | Bacteria | NA | NA | Nucleic Acid | Natural | elicit innate immune response | Nod-like receptor protein 12(NLRP12) | NOD-like receptor (NLR) | Human | plasmacytoid and myeloid DCs | extracellular domain (ECD) | Q9NR97.fasta | Q9NR97 | 1041 | controlling antiviral host defense or autoimmune diseases and TLR8 and respond to its activation with TNF production and/or degranulation | Microarray analysis, Quantitative PCR, Phosphoproteomic screen, Confocal cell imaging,RNA40 pull-down assay and Immunoblot | 24813206 | 2014 | Pubchem_assay |
| PRRID_1186 | bacterialRNA Click for more detail | Bacteria | NA | NA | Nucleic Acid | Natural | elicit innate immune response | Nod-like receptor protein 12(NLRP12) | NOD-like receptor (NLR) | Human | plasmacytoid and myeloid DCs | extracellular domain (ECD) | Q9NR97.fasta | Q9NR97 | 1041 | controlling antiviral host defense or autoimmune diseases and TLR8 and respond to its activation with TNF production and/or degranulation | Microarray analysis, Quantitative PCR, Phosphoproteomic screen, Confocal cell imaging,RNA40 pull-down assay and Immunoblot | 24813206 | 2014 | Pubchem_assay |
| PRRID_1192 | CARDs Click for more detail | Bacteria | NA | NA | Protein | Natural | NA | CAD | NOD-like receptor (NLR) | NA | NA | NA | NA | NA | NA | NA | NA | 25520185 | 2014 | NA |
| PRRID_1192 | CARDs Click for more detail | Bacteria | NA | NA | Protein | Natural | NA | CAD | NOD-like receptor (NLR) | NA | NA | NA | NA | NA | NA | NA | NA | 25520185 | 2014 | NA |
| PRRID_1193 | CARDs Click for more detail | Bacteria | NA | NA | Protein | Natural | NA | Caspase-1 | NOD-like receptor (NLR) | NA | NA | NA | NA | NA | NA | NA | NA | 25520185 | 2014 | NA |
| PRRID_1193 | CARDs Click for more detail | Bacteria | NA | NA | Protein | Natural | NA | Caspase-1 | NOD-like receptor (NLR) | NA | NA | NA | NA | NA | NA | NA | NA | 25520185 | 2014 | NA |
| PRRID_1194 | CARDs Click for more detail | Bacteria | NA | NA | Protein | Natural | NA | HSP90 | NOD-like receptor (NLR) | NA | NA | NA | NA | NA | NA | NA | NA | 25520185 | 2014 | NA |
| PRRID_1194 | CARDs Click for more detail | Bacteria | NA | NA | Protein | Natural | NA | HSP90 | NOD-like receptor (NLR) | NA | NA | NA | NA | NA | NA | NA | NA | 25520185 | 2014 | NA |
| PRRID_1195 | CARDs Click for more detail | Bacteria | NA | NA | Protein | Natural | NA | Nod-like receptor protein 1 (NLRP1) | NOD-like receptor (NLR) | NA | NA | NA | NA | NA | NA | NA | NA | 25520185 | 2014 | NA |
| PRRID_1195 | CARDs Click for more detail | Bacteria | NA | NA | Protein | Natural | NA | Nod-like receptor protein 1 (NLRP1) | NOD-like receptor (NLR) | NA | NA | NA | NA | NA | NA | NA | NA | 25520185 | 2014 | NA |
| PRRID_1196 | CARDs Click for more detail | Bacteria | NA | NA | Protein | Natural | NA | Nod-like receptor P3 (NLRP3) | NOD-like receptor (NLR) | NA | NA | NA | NA | NA | NA | NA | NA | 25520185 | 2014 | NA |
| PRRID_1196 | CARDs Click for more detail | Bacteria | NA | NA | Protein | Natural | NA | Nod-like receptor P3 (NLRP3) | NOD-like receptor (NLR) | NA | NA | NA | NA | NA | NA | NA | NA | 25520185 | 2014 | NA |
| PRRID_1197 | CARDs Click for more detail | Bacteria | NA | NA | Protein | Natural | NA | Nod-like receptor protein 12 (NLRP12) | NOD-like receptor (NLR) | NA | NA | NA | NA | NA | NA | NA | NA | 25520185 | 2014 | NA |
| PRRID_1197 | CARDs Click for more detail | Bacteria | NA | NA | Protein | Natural | NA | Nod-like receptor protein 12 (NLRP12) | NOD-like receptor (NLR) | NA | NA | NA | NA | NA | NA | NA | NA | 25520185 | 2014 | NA |
| PRRID_1199 | CARDs Click for more detail | Bacteria | NA | NA | Protein | Natural | NA | SOCS-3 | NOD-like receptor (NLR) | NA | NA | NA | NA | NA | NA | NA | NA | 25520185 | 2014 | NA |
| PRRID_1199 | CARDs Click for more detail | Bacteria | NA | NA | Protein | Natural | NA | SOCS-3 | NOD-like receptor (NLR) | NA | NA | NA | NA | NA | NA | NA | NA | 25520185 | 2014 | NA |
| PRRID_1202 | LRR Click for more detail | Bacteria | NA | NA | Protein | Natural | NA | DUOX2 | NOD-like receptor (NLR) | NA | NA | NA | NA | NA | NA | NA | NA | 25520185 | 2014 | NA |
| PRRID_1202 | LRR Click for more detail | Bacteria | NA | NA | Protein | Natural | NA | DUOX2 | NOD-like receptor (NLR) | NA | NA | NA | NA | NA | NA | NA | NA | 25520185 | 2014 | NA |
| PRRID_1203 | CARDS Click for more detail | Bacteria | NA | NA | Protein | Natural | NA | FRMPD2 | NOD-like receptor (NLR) | NA | NA | NA | NA | NA | NA | NA | NA | 25520185 | 2014 | NA |
| PRRID_1203 | CARDS Click for more detail | Bacteria | NA | NA | Protein | Natural | NA | FRMPD2 | NOD-like receptor (NLR) | NA | NA | NA | NA | NA | NA | NA | NA | 25520185 | 2014 | NA |
| PRRID_1364 | iE-DAP (gamma-D-glutamyl-meso diaminopimelic acid) Click for more detail | Gram-negative and Gram-positive bacteria | N[C@@H](CCC[C@@H](NC(=O)CC[C@@H](N)C(O)=O)C(O)=O)C(O)=O | NA | Pattern-associated molecular patterns (PAMPs) | Natural | activate NF-κB | Nucleotide Binding Oligomerization Domain Containing 1 (Nod1) | NOD-like receptor (NLR) | European and African Children | signals via a caspase- activated recruitment domain (CARD) | signals via a caspase- activated recruitment domain (CARD) | Q9Y239.fasta | Q9Y239 | 953 | plays a fundamental role in pathogen recognition and activation of innate immunity | ELISA | 24743542 | 2014 | Pubchem_assay |
| PRRID_1364 | iE-DAP (gamma-D-glutamyl-meso diaminopimelic acid) Click for more detail | Gram-negative and Gram-positive bacteria | N[C@@H](CCC[C@@H](NC(=O)CC[C@@H](N)C(O)=O)C(O)=O)C(O)=O | NA | Pattern-associated molecular patterns (PAMPs) | Natural | activate NF-κB | Nucleotide Binding Oligomerization Domain Containing 1 (Nod1) | NOD-like receptor (NLR) | European and African Children | signals via a caspase- activated recruitment domain (CARD) | signals via a caspase- activated recruitment domain (CARD) | Q9Y239.fasta | Q9Y239 | 953 | plays a fundamental role in pathogen recognition and activation of innate immunity | ELISA | 24743542 | 2014 | Pubchem_assay |
| PRRID_1381 | internalized flagellin Click for more detail | Salmonella typhimurium or Legionella pneumophila (Bacteria) | KLSFEDKNGKVIDGGYAVKMGDDFYAATYDEKTGAITAKTTTYTDGTGVAQTGAVKFGGANGKSEVVTATDGKTYL | 76 | Protein | Natural | Flagellin and LPS stimulate the production of CXCL1 and CXCL2 | Nod-like receptor C4 (NLRC4) | NOD-like receptor (NLR) | Mice | medullary collecting duct (MCD) cells | intracellular receptors | Q3UP24.fasta | Q3UP24 | 1024 | assemble in an inflammasome complex to activate caspase-1 and promote the release of IL-1β and IL-18 | ELISA, adhesion and invasion assay | 24779433 | 2014 | Pubchem_assay |
| PRRID_1381 | internalized flagellin Click for more detail | Salmonella typhimurium or Legionella pneumophila (Bacteria) | KLSFEDKNGKVIDGGYAVKMGDDFYAATYDEKTGAITAKTTTYTDGTGVAQTGAVKFGGANGKSEVVTATDGKTYL | 76 | Protein | Natural | Flagellin and LPS stimulate the production of CXCL1 and CXCL2 | Nod-like receptor C4 (NLRC4) | NOD-like receptor (NLR) | Mice | medullary collecting duct (MCD) cells | intracellular receptors | Q3UP24.fasta | Q3UP24 | 1024 | assemble in an inflammasome complex to activate caspase-1 and promote the release of IL-1β and IL-18 | ELISA, adhesion and invasion assay | 24779433 | 2014 | Pubchem_assay |
| PRRID_1382 | internalized flagellin Click for more detail | Salmonella typhimurium or Legionella pneumophila (Bacteria) | KLSFEDKNGKVIDGGYAVKMGDDFYAATYDEKTGAITAKTTTYTDGTGVAQTGAVKFGGANGKSEVVTATDGKTYL | 76 | Protein | Natural | Flagellin and LPS stimulate the production of CXCL1 and CXCL2 | Nod-like receptor C4 (NLRC4) | NOD-like receptor (NLR) | Human | medullary collecting duct (MCD) cells | intracellular receptors | Q9NPP4.fasta | Q9NPP4 | 1024 | assemble in an inflammasome complex to activate caspase-1 and promote the release of IL-1β and IL-18 | ELISA, adhesion and invasion assay | 24779433 | 2014 | Pubchem_assay |
| PRRID_1382 | internalized flagellin Click for more detail | Salmonella typhimurium or Legionella pneumophila (Bacteria) | KLSFEDKNGKVIDGGYAVKMGDDFYAATYDEKTGAITAKTTTYTDGTGVAQTGAVKFGGANGKSEVVTATDGKTYL | 76 | Protein | Natural | Flagellin and LPS stimulate the production of CXCL1 and CXCL2 | Nod-like receptor C4 (NLRC4) | NOD-like receptor (NLR) | Human | medullary collecting duct (MCD) cells | intracellular receptors | Q9NPP4.fasta | Q9NPP4 | 1024 | assemble in an inflammasome complex to activate caspase-1 and promote the release of IL-1β and IL-18 | ELISA, adhesion and invasion assay | 24779433 | 2014 | Pubchem_assay |
| PRRID_1386 | L-ornithine muramyl tripeptide Click for more detail | Gram-positive bacteria and some Gram-negative spirochaetes. | CCCCCCCCCCCCCCCC(=O)OC[C@H](COP(=O)(O)OCCNC(=O)[C@H](C)NC(=O)CC[C@@H](NC(=O)[C@H](C)NC(=O)[C@@H](C)O[C@@H]([C@H](O)[C@H](O)CO)[C@@H](NC(=O)C)C=O)C(=O)N)OC(=O)CCCCCCCCCCCCCCC | NA | Peptide | Natural | in vitro activates Nod | Nucleotide Binding Oligomerization Domain Containing 2 (Nod2) | NOD-like receptor (NLR) | Mice | immune cells like peripheral blood monocytes, granulocytes and dendritic cells, as well as in astrocytes of the brain and in paneth cells of the gut | intracellular receptors | Q8K3Z0.fasta | Q8K3Z0 | 1020 | Nod2, are associ- ated with inflammatory bowel disease in humans | NA | 24779390 | 2014 | Pubchem_assay |
| PRRID_1386 | L-ornithine muramyl tripeptide Click for more detail | Gram-positive bacteria and some Gram-negative spirochaetes. | CCCCCCCCCCCCCCCC(=O)OC[C@H](COP(=O)(O)OCCNC(=O)[C@H](C)NC(=O)CC[C@@H](NC(=O)[C@H](C)NC(=O)[C@@H](C)O[C@@H]([C@H](O)[C@H](O)CO)[C@@H](NC(=O)C)C=O)C(=O)N)OC(=O)CCCCCCCCCCCCCCC | NA | Peptide | Natural | in vitro activates Nod | Nucleotide Binding Oligomerization Domain Containing 2 (Nod2) | NOD-like receptor (NLR) | Mice | immune cells like peripheral blood monocytes, granulocytes and dendritic cells, as well as in astrocytes of the brain and in paneth cells of the gut | intracellular receptors | Q8K3Z0.fasta | Q8K3Z0 | 1020 | Nod2, are associ- ated with inflammatory bowel disease in humans | NA | 24779390 | 2014 | Pubchem_assay |
| PRRID_1387 | L-ornithine muramyl tripeptide Click for more detail | Gram-positive bacteria and some Gram-negative spirochaetes. | CCCCCCCCCCCCCCCC(=O)OC[C@H](COP(=O)(O)OCCNC(=O)[C@H](C)NC(=O)CC[C@@H](NC(=O)[C@H](C)NC(=O)[C@@H](C)O[C@@H]([C@H](O)[C@H](O)CO)[C@@H](NC(=O)C)C=O)C(=O)N)OC(=O)CCCCCCCCCCCCCCC | NA | Peptide | Natural | in vitro activates Nod | Nucleotide Binding Oligomerization Domain Containing 2 (Nod2) | NOD-like receptor (NLR) | Human | immune cells like peripheral blood monocytes, granulocytes and dendritic cells, as well as in astrocytes of the brain and in paneth cells of the gut | intracellular receptors | Q9HC29.fasta | Q9HC29 | 1040 | Nod2, are associ- ated with inflammatory bowel disease in humans | NA | 24779390 | 2014 | Pubchem_assay |
| PRRID_1387 | L-ornithine muramyl tripeptide Click for more detail | Gram-positive bacteria and some Gram-negative spirochaetes. | CCCCCCCCCCCCCCCC(=O)OC[C@H](COP(=O)(O)OCCNC(=O)[C@H](C)NC(=O)CC[C@@H](NC(=O)[C@H](C)NC(=O)[C@@H](C)O[C@@H]([C@H](O)[C@H](O)CO)[C@@H](NC(=O)C)C=O)C(=O)N)OC(=O)CCCCCCCCCCCCCCC | NA | Peptide | Natural | in vitro activates Nod | Nucleotide Binding Oligomerization Domain Containing 2 (Nod2) | NOD-like receptor (NLR) | Human | immune cells like peripheral blood monocytes, granulocytes and dendritic cells, as well as in astrocytes of the brain and in paneth cells of the gut | intracellular receptors | Q9HC29.fasta | Q9HC29 | 1040 | Nod2, are associ- ated with inflammatory bowel disease in humans | NA | 24779390 | 2014 | Pubchem_assay |
| PRRID_1472 | LRR Click for more detail | Bacteria | NA | NA | Protein | Natural | NA | DUOX2 | NOD-like receptor (NLR) | NA | NA | NA | NA | NA | NA | NA | NA | 25520185 | 2014 | NA |
| PRRID_1472 | LRR Click for more detail | Bacteria | NA | NA | Protein | Natural | NA | DUOX2 | NOD-like receptor (NLR) | NA | NA | NA | NA | NA | NA | NA | NA | 25520185 | 2014 | NA |
| PRRID_1473 | LRR Click for more detail | Bacteria | NA | NA | Protein | Natural | NA | FRMPD2 | NOD-like receptor (NLR) | NA | stabilizes NOD2, required for NF-kB signalling | NA | NA | NA | NA | NA | NA | 25520185 | 2014 | NA |
| PRRID_1473 | LRR Click for more detail | Bacteria | NA | NA | Protein | Natural | NA | FRMPD2 | NOD-like receptor (NLR) | NA | stabilizes NOD2, required for NF-kB signalling | NA | NA | NA | NA | NA | NA | 25520185 | 2014 | NA |
| PRRID_1483 | meso-diaminopomelic acid (meso- DAP) Click for more detail | Gram-negative bacteria and several Gram-positive bacteria such as Listeria and Bacillus spp | C(CC(C(=O)O)N)CC(C(=O)O)N | NA | Peptide | Natural | in vitro activates Nod1 | Nucleotide Binding Oligomerization Domain Containing 1 (Nod1) | NOD-like receptor (NLR) | Human | macrophages and mesothelial cells | serine/threonine RIP2 (RICK, CARDIAK) kinase | Q9Y239.fasta | Q9Y239 | 953 | Nod1 ligation also leads to the activation of NF-jB and MAPKs in neutrophils | ELISA | 24766550 | 2014 | Pubchem_assay |
| PRRID_1483 | meso-diaminopomelic acid (meso- DAP) Click for more detail | Gram-negative bacteria and several Gram-positive bacteria such as Listeria and Bacillus spp | C(CC(C(=O)O)N)CC(C(=O)O)N | NA | Peptide | Natural | in vitro activates Nod1 | Nucleotide Binding Oligomerization Domain Containing 1 (Nod1) | NOD-like receptor (NLR) | Human | macrophages and mesothelial cells | serine/threonine RIP2 (RICK, CARDIAK) kinase | Q9Y239.fasta | Q9Y239 | 953 | Nod1 ligation also leads to the activation of NF-jB and MAPKs in neutrophils | ELISA | 24766550 | 2014 | Pubchem_assay |
| PRRID_1484 | meso-lanthionine tripeptide Click for more detail | PGN of the anaerobic bacterium Fusobacterium nucleatum (Bacteria) | NA | NA | Peptide | Natural | in vitro activates Nod | Nucleotide Binding Oligomerization Domain Containing 1 (Nod1) | NOD-like receptor (NLR) | Mice | most adult tissues | intracellular receptors | Q8BHB0.fasta | Q8BHB0 | 953 | play key roles in regulation of innate immune response. NLRs can cooperate with Toll-like receptors and regulate inflammatory and apoptotic response. | NA | 24779390 | 2014 | Pubchem_assay |
| PRRID_1484 | meso-lanthionine tripeptide Click for more detail | PGN of the anaerobic bacterium Fusobacterium nucleatum (Bacteria) | NA | NA | Peptide | Natural | in vitro activates Nod | Nucleotide Binding Oligomerization Domain Containing 1 (Nod1) | NOD-like receptor (NLR) | Mice | most adult tissues | intracellular receptors | Q8BHB0.fasta | Q8BHB0 | 953 | play key roles in regulation of innate immune response. NLRs can cooperate with Toll-like receptors and regulate inflammatory and apoptotic response. | NA | 24779390 | 2014 | Pubchem_assay |
| PRRID_1485 | meso-lanthionine tripeptide Click for more detail | PGN of the anaerobic bacterium Fusobacterium nucleatum (Bacteria) | NA | NA | Peptide | Natural | in vitro activates Nod | Nucleotide Binding Oligomerization Domain Containing 1 (Nod1) | NOD-like receptor (NLR) | Human | most adult tissues | intracellular receptors | Q9Y239.fasta | Q9Y239 | 953 | play key roles in regulation of innate immune response. NLRs can cooperate with Toll-like receptors and regulate inflammatory and apoptotic response. | NA | 24779390 | 2014 | Pubchem_assay |
| PRRID_1485 | meso-lanthionine tripeptide Click for more detail | PGN of the anaerobic bacterium Fusobacterium nucleatum (Bacteria) | NA | NA | Peptide | Natural | in vitro activates Nod | Nucleotide Binding Oligomerization Domain Containing 1 (Nod1) | NOD-like receptor (NLR) | Human | most adult tissues | intracellular receptors | Q9Y239.fasta | Q9Y239 | 953 | play key roles in regulation of innate immune response. NLRs can cooperate with Toll-like receptors and regulate inflammatory and apoptotic response. | NA | 24779390 | 2014 | Pubchem_assay |
| PRRID_1489 | mRNA Click for more detail | RNA virus (Virus) | NA | NA | Nucleic Acid | Natural | triggers immune responses | Nucleotide Binding Oligomerization Domain Containing 2 (Nod2) | NOD-like receptor (NLR) | Mice | Dendritic Cell, B-lymphocyte | cell compartment | Q8K3Z0.fasta | Q8K3Z0 | 1020 | Possible effect in case of stroke i.e it is Involved in preconditioning and No protection after gene knockout following cerebral ischemia | NA | 24807166 | 2014 | Pubchem_assay |
| PRRID_1489 | mRNA Click for more detail | RNA virus (Virus) | NA | NA | Nucleic Acid | Natural | triggers immune responses | Nucleotide Binding Oligomerization Domain Containing 2 (Nod2) | NOD-like receptor (NLR) | Mice | Dendritic Cell, B-lymphocyte | cell compartment | Q8K3Z0.fasta | Q8K3Z0 | 1020 | Possible effect in case of stroke i.e it is Involved in preconditioning and No protection after gene knockout following cerebral ischemia | NA | 24807166 | 2014 | Pubchem_assay |
| PRRID_1491 | muramyl dipeptide (MDP) Click for more detail | Gram-positive and negative bacteria | CC(C(=O)NC(CCC(=O)O)C(=O)N)NC(=O)C(C)OC1C(C(OC(C1O)CO)O)NC(=O)C | NA | Peptide | Natural | leads to cytokine activation, especially IL-1α and IL-1β. | Nucleotide Binding Oligomerization Domain Containing 2 (Nod2) | NOD-like receptor (NLR) | Human | peripheral blood mononuclear cells such as macrophages, granulocytes, dendritic cells, and along the intestinal epithelial cells | intracellular receptors | Q9HC29.fasta | Q9HC29 | 1040 | recognizes fragments of the bacterial cell wall. | Luciferase assay | 24790089 | 2014 | Pubchem_assay |
| PRRID_1491 | muramyl dipeptide (MDP) Click for more detail | Gram-positive and negative bacteria | CC(C(=O)NC(CCC(=O)O)C(=O)N)NC(=O)C(C)OC1C(C(OC(C1O)CO)O)NC(=O)C | NA | Peptide | Natural | leads to cytokine activation, especially IL-1α and IL-1β. | Nucleotide Binding Oligomerization Domain Containing 2 (Nod2) | NOD-like receptor (NLR) | Human | peripheral blood mononuclear cells such as macrophages, granulocytes, dendritic cells, and along the intestinal epithelial cells | intracellular receptors | Q9HC29.fasta | Q9HC29 | 1040 | recognizes fragments of the bacterial cell wall. | Luciferase assay | 24790089 | 2014 | Pubchem_assay |
| PRRID_1492 | muramyl dipeptide (MDP) Click for more detail | Gram-positive and negative bacteria | CC(C(=O)NC(CCC(=O)O)C(=O)N)NC(=O)C(C)OC1C(C(OC(C1O)CO)O)NC(=O)C | NA | Peptidoglycan | Natural | leads to cytokine activation, especially IL-1α and IL-1β. | Nucleotide Binding Oligomerization Domain Containing 2 (Nod2) | NOD-like receptor (NLR) | Human | peripheral mononuclear cells and monocyte-derived dendritic cells (Mo-DCs) from CD pateints | intracellular receptors | Q9HC29.fasta | Q9HC29 | 1040 | Innate immune responses mediated by NOD2, including production of pro-inflammatory cytokines and antimicrobial peptides, as well as induction of autophagy, are thought to have a central role in the pathogenesis of CD and these processes are impaired in patients homozygous for NOD2 mutations | ELISA | 24781050 | 2014 | Pubchem_assay |
| PRRID_1492 | muramyl dipeptide (MDP) Click for more detail | Gram-positive and negative bacteria | CC(C(=O)NC(CCC(=O)O)C(=O)N)NC(=O)C(C)OC1C(C(OC(C1O)CO)O)NC(=O)C | NA | Peptidoglycan | Natural | leads to cytokine activation, especially IL-1α and IL-1β. | Nucleotide Binding Oligomerization Domain Containing 2 (Nod2) | NOD-like receptor (NLR) | Human | peripheral mononuclear cells and monocyte-derived dendritic cells (Mo-DCs) from CD pateints | intracellular receptors | Q9HC29.fasta | Q9HC29 | 1040 | Innate immune responses mediated by NOD2, including production of pro-inflammatory cytokines and antimicrobial peptides, as well as induction of autophagy, are thought to have a central role in the pathogenesis of CD and these processes are impaired in patients homozygous for NOD2 mutations | ELISA | 24781050 | 2014 | Pubchem_assay |
| PRRID_1493 | muramyl dipeptide (MDP) Click for more detail | Gram-negative and Gram-positive bacteria | CC(C(=O)NC(CCC(=O)O)C(=O)N)NC(=O)C(C)OC1C(C(OC(C1O)CO)O)NC(=O)C | NA | Peptide | Natural | induces interleu- kin-8 (IL-8) production, CD62 ligand shedding, and CD11b up-regulation | Nucleotide Binding Oligomerization Domain Containing 2 (Nod2) | NOD-like receptor (NLR) | Mice | Neutrophils | serine/threonine RIP2 (RICK, CARDIAK) kinase | Q8K3Z0.fasta | Q8K3Z0 | 1020 | involved in neutrophil immune responses in response to bacterial infection. | ELISA | 24766550 | 2014 | Pubchem_assay |
| PRRID_1493 | muramyl dipeptide (MDP) Click for more detail | Gram-negative and Gram-positive bacteria | CC(C(=O)NC(CCC(=O)O)C(=O)N)NC(=O)C(C)OC1C(C(OC(C1O)CO)O)NC(=O)C | NA | Peptide | Natural | induces interleu- kin-8 (IL-8) production, CD62 ligand shedding, and CD11b up-regulation | Nucleotide Binding Oligomerization Domain Containing 2 (Nod2) | NOD-like receptor (NLR) | Mice | Neutrophils | serine/threonine RIP2 (RICK, CARDIAK) kinase | Q8K3Z0.fasta | Q8K3Z0 | 1020 | involved in neutrophil immune responses in response to bacterial infection. | ELISA | 24766550 | 2014 | Pubchem_assay |
| PRRID_1494 | muramyl dipeptide (MDP) Click for more detail | Gram-negative and Gram-positive bacteria | CC(C(=O)NC(CCC(=O)O)C(=O)N)NC(=O)C(C)OC1C(C(OC(C1O)CO)O)NC(=O)C | NA | Peptide | Natural | induces interleu- kin-8 (IL-8) production, CD62 ligand shedding, and CD11b up-regulation | Nucleotide Binding Oligomerization Domain Containing 2 (Nod2) | NOD-like receptor (NLR) | Human | Neutrophils | serine/threonine RIP2 (RICK, CARDIAK) kinase | Q8K3Z0.fasta | Q8K3Z0 | 1020 | involved in neutrophil immune responses in response to bacterial infection. | ELISA | 24766550 | 2014 | Pubchem_assay |
| PRRID_1494 | muramyl dipeptide (MDP) Click for more detail | Gram-negative and Gram-positive bacteria | CC(C(=O)NC(CCC(=O)O)C(=O)N)NC(=O)C(C)OC1C(C(OC(C1O)CO)O)NC(=O)C | NA | Peptide | Natural | induces interleu- kin-8 (IL-8) production, CD62 ligand shedding, and CD11b up-regulation | Nucleotide Binding Oligomerization Domain Containing 2 (Nod2) | NOD-like receptor (NLR) | Human | Neutrophils | serine/threonine RIP2 (RICK, CARDIAK) kinase | Q8K3Z0.fasta | Q8K3Z0 | 1020 | involved in neutrophil immune responses in response to bacterial infection. | ELISA | 24766550 | 2014 | Pubchem_assay |
| PRRID_1497 | N-glycolylated muramic acid Click for more detail | Mycobacterium smegmatis and Mycobacterium tuberculosis (Bacteria) | CC(C(=O)O)OC1C(C(OC(C1O)CO)O)NC(=O)C | NA | Carbohydrate | Natural | activates NOD2 | Nod-like receptor 1 (NLR1) | NOD-like receptor (NLR) | Mice | immune cells like peripheral blood monocytes, granulocytes and dendritic cells, as well as in astrocytes of the brain and in paneth cells of the gut | intracellular receptors | Q8K3Z0.fasta | Q8K3Z0 | 1020 | Nod2, are associ- ated with inflammatory bowel disease in humans | NA | 24779390 | 2014 | Pubchem_assay |
| PRRID_1497 | N-glycolylated muramic acid Click for more detail | Mycobacterium smegmatis and Mycobacterium tuberculosis (Bacteria) | CC(C(=O)O)OC1C(C(OC(C1O)CO)O)NC(=O)C | NA | Carbohydrate | Natural | activates NOD2 | Nod-like receptor 1 (NLR1) | NOD-like receptor (NLR) | Mice | immune cells like peripheral blood monocytes, granulocytes and dendritic cells, as well as in astrocytes of the brain and in paneth cells of the gut | intracellular receptors | Q8K3Z0.fasta | Q8K3Z0 | 1020 | Nod2, are associ- ated with inflammatory bowel disease in humans | NA | 24779390 | 2014 | Pubchem_assay |
| PRRID_1498 | N-glycolylated muramic acid Click for more detail | Mycobacterium smegmatis and Mycobacterium tuberculosis (Bacteria) | CC(C(=O)O)OC1C(C(OC(C1O)CO)O)NC(=O)C | NA | Carbohydrate | Natural | activates NOD2 | Nod-like receptor 1 (NLR1) | NOD-like receptor (NLR) | Human | immune cells like peripheral blood monocytes, granulocytes and dendritic cells, as well as in astrocytes of the brain and in paneth cells of the gut | intracellular receptors | Q9HC29.fasta | Q9HC29 | 1040 | Nod2, are associ- ated with inflammatory bowel disease in humans | NA | 24779390 | 2014 | Pubchem_assay |
| PRRID_1498 | N-glycolylated muramic acid Click for more detail | Mycobacterium smegmatis and Mycobacterium tuberculosis (Bacteria) | CC(C(=O)O)OC1C(C(OC(C1O)CO)O)NC(=O)C | NA | Carbohydrate | Natural | activates NOD2 | Nod-like receptor 1 (NLR1) | NOD-like receptor (NLR) | Human | immune cells like peripheral blood monocytes, granulocytes and dendritic cells, as well as in astrocytes of the brain and in paneth cells of the gut | intracellular receptors | Q9HC29.fasta | Q9HC29 | 1040 | Nod2, are associ- ated with inflammatory bowel disease in humans | NA | 24779390 | 2014 | Pubchem_assay |
| PRRID_1504 | NACHT Click for more detail | Bacteria | NA | NA | Protein | Natural | NA | CARD8 | NOD-like receptor (NLR) | NA | NA | NA | NA | NA | NA | NA | NA | 25520185 | 2014 | NA |
| PRRID_1504 | NACHT Click for more detail | Bacteria | NA | NA | Protein | Natural | NA | CARD8 | NOD-like receptor (NLR) | NA | NA | NA | NA | NA | NA | NA | NA | 25520185 | 2014 | NA |
| PRRID_1505 | NACHT Click for more detail | Bacteria | NA | NA | Protein | Natural | NA | Nod-like receptor C4 (NLRC4) | NOD-like receptor (NLR) | NA | NA | NA | NA | NA | NA | NA | NA | 25520185 | 2014 | NA |
| PRRID_1505 | NACHT Click for more detail | Bacteria | NA | NA | Protein | Natural | NA | Nod-like receptor C4 (NLRC4) | NOD-like receptor (NLR) | NA | NA | NA | NA | NA | NA | NA | NA | 25520185 | 2014 | NA |
| PRRID_1506 | NACHT Click for more detail | Bacteria | NA | NA | Protein | Natural | NA | TRIM27 | NOD-like receptor (NLR) | NA | NA | NA | NA | NA | NA | NA | NA | 25520185 | 2014 | NA |
| PRRID_1506 | NACHT Click for more detail | Bacteria | NA | NA | Protein | Natural | NA | TRIM27 | NOD-like receptor (NLR) | NA | NA | NA | NA | NA | NA | NA | NA | 25520185 | 2014 | NA |
| PRRID_1507 | NACHT-LRR Click for more detail | Bacteria | NA | NA | Protein | Natural | NA | MAVS | NOD-like receptor (NLR) | NA | NA | NA | NA | NA | NA | NA | NA | 25520185 | 2014 | NA |
| PRRID_1507 | NACHT-LRR Click for more detail | Bacteria | NA | NA | Protein | Natural | NA | MAVS | NOD-like receptor (NLR) | NA | NA | NA | NA | NA | NA | NA | NA | 25520185 | 2014 | NA |
| PRRID_1508 | NACHT-LRR Click for more detail | Virus | NA | NA | Protein | Natural | NA | NIK | NOD-like receptor (NLR) | NA | antiviral defence | NA | NA | NA | NA | NA | NA | 25520185 | 2014 | NA |
| PRRID_1508 | NACHT-LRR Click for more detail | Virus | NA | NA | Protein | Natural | NA | NIK | NOD-like receptor (NLR) | NA | antiviral defence | NA | NA | NA | NA | NA | NA | 25520185 | 2014 | NA |