| Primary information |
|---|
| PRRID | PRRID_1381 |
| Ligand Name | internalized flagellin |
| Source | Salmonella typhimurium or Legionella pneumophila (Bacteria) |
| Sequence of ligand | KLSFEDKNGKVIDGGYAVKMGDDFYAATYDEKTGAITAKTTTYTDGTGVAQTGAVKFGGANGKSEVVTATDGKTYL |
| Length | 76 |
| Type | Protein |
| Occurence | Natural |
| Role of Ligand | Flagellin and LPS stimulate the production of CXCL1 and CXCL2 |
| Name of receptor | Nod-like receptor C4 (NLRC4) |
| Type of receptor | NOD-like receptor (NLR) |
| Source | Mice |
| Localization | medullary collecting duct (MCD) cells |
| Domain | intracellular receptors |
| Sequence of Receptor | Q3UP24.fasta |
| Swiss prot ID | Q3UP24 |
| Length Of Receptor | 1024 |
| Function | assemble in an inflammasome complex to activate caspase-1 and promote the release of IL-1β and IL-18 |
| Assay used | ELISA, adhesion and invasion assay |
| PMID | 24779433 |
| Year of Publication | 2014 |
| Pubchem assay | Pubchem_assay |
| Primary information |
|---|
| PRRID | PRRID_1381 |
| Ligand Name | internalized flagellin |
| Source | Salmonella typhimurium or Legionella pneumophila (Bacteria) |
| Sequence of ligand | KLSFEDKNGKVIDGGYAVKMGDDFYAATYDEKTGAITAKTTTYTDGTGVAQTGAVKFGGANGKSEVVTATDGKTYL |
| Length | 76 |
| Type | Protein |
| Occurence | Natural |
| Role of Ligand | Flagellin and LPS stimulate the production of CXCL1 and CXCL2 |
| Name of receptor | Nod-like receptor C4 (NLRC4) |
| Type of receptor | NOD-like receptor (NLR) |
| Source | Mice |
| Localization | medullary collecting duct (MCD) cells |
| Domain | intracellular receptors |
| Sequence of Receptor | Q3UP24.fasta |
| Swiss prot ID | Q3UP24 |
| Length Of Receptor | 1024 |
| Function | assemble in an inflammasome complex to activate caspase-1 and promote the release of IL-1β and IL-18 |
| Assay used | ELISA, adhesion and invasion assay |
| PMID | 24779433 |
| Year of Publication | 2014 |
| Pubchem assay | Pubchem_assay |