Browse result page of PRRDB 2.0
| PRRID | Name of Ligand | Source of ligand | Sequence of Ligand | Length of Ligand | Type of Ligand | Occurence | Role of Ligand | Name of Receptor | Type of Reeptor | Source of the Receptor | Localization | Domain | Sequence of Receptor | Swiss prot ID | Length of receptor | Function of Receptor | Assay used | PMID | Year of publication | Pubchem assay |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| PRRID_0233 | 3M-001 Click for more detail | small chemical derivatives (others) | NA | NA | imidazoquinolines | Synthetic | elicit innate immune response | Toll-like receptor 7 (TLR7) | Toll-like receptor (TLR) | Human | dendritic cells | NA | Q9NYK1.fasta | Q9NYK1 | 1049 | production of pro-inflammatory cytokines | NA | 17114492 | 2006 | Pubchem Assay |
| PRRID_0233 | 3M-001 Click for more detail | small chemical derivatives (others) | NA | NA | imidazoquinolines | Synthetic | elicit innate immune response | Toll-like receptor 7 (TLR7) | Toll-like receptor (TLR) | Human | dendritic cells | NA | Q9NYK1.fasta | Q9NYK1 | 1049 | production of pro-inflammatory cytokines | NA | 17114492 | 2006 | Pubchem Assay |
| PRRID_0235 | 3M-002 Click for more detail | small chemical derivatives (others) | NA | NA | imidazoquinolines | Synthetic | elicit innate immune response | Toll-like receptor 8 (TLR8) | Toll-like receptor (TLR) | Human | dendritic cells | NA | Q9NR97.fasta | Q9NR97 | 1041 | production of pro-inflammatory cytokines | NA | 17114492 | 2006 | Pubchem Assay |
| PRRID_0235 | 3M-002 Click for more detail | small chemical derivatives (others) | NA | NA | imidazoquinolines | Synthetic | elicit innate immune response | Toll-like receptor 8 (TLR8) | Toll-like receptor (TLR) | Human | dendritic cells | NA | Q9NR97.fasta | Q9NR97 | 1041 | production of pro-inflammatory cytokines | NA | 17114492 | 2006 | Pubchem Assay |
| PRRID_0239 | Apoptotic cells Click for more detail | Endogenous (others) | NA | NA | Others | Natural | Immunostimulant | cluster of differentiation 36 (CD36) | Pattern recognition receptor (PRR) | Human | NA | transmembrane domains, contains both a ‘neck’ domain and the C-type lectin fold. | P16671.fasta | P16671 | 472 | NA | Protein lipid overlay assay | 16146427 | 2006 | Pubchem Assay |
| PRRID_0239 | Apoptotic cells Click for more detail | Endogenous (others) | NA | NA | Others | Natural | Immunostimulant | cluster of differentiation 36 (CD36) | Pattern recognition receptor (PRR) | Human | NA | transmembrane domains, contains both a ‘neck’ domain and the C-type lectin fold. | P16671.fasta | P16671 | 472 | NA | Protein lipid overlay assay | 16146427 | 2006 | Pubchem Assay |
| PRRID_0246 | Lipopolysaccharide (LPS) Click for more detail | Gram-negative bacteria | CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC | NA | Lipopolysaccharide (LPS) | Natural | Immunostimulant | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Human | NA | NA | O60603.fasta | O60603 | 784 | NA | NA | 16861291 | 2006 | Pubchem Assay |
| PRRID_0246 | Lipopolysaccharide (LPS) Click for more detail | Gram-negative bacteria | CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC | NA | Lipopolysaccharide (LPS) | Natural | Immunostimulant | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Human | NA | NA | O60603.fasta | O60603 | 784 | NA | NA | 16861291 | 2006 | Pubchem Assay |
| PRRID_0250 | Small Heat Shock Protein B8 (HSP22) Click for more detail | Host (Endogenous) (others) | MADGQMPFSCHYPSRLRRDPFRDSPLSSRLLDDGFGMDPFPDDLTASWPDWALPRLSSAWPGTLRSGMVPRGPTATARFGVPAEGRTPPPFPGEPWKVCVNVHSFKPEELMVKTKDGYVEVSGKHEEKQQEGGIVSKNFTKKIQLPAEVDPVTVFASLSPEGLLIIEAPQVPPYSTFGESSFNNELPQDSQEVTCT | 496 | Protein | Natural | It leads to the increased production of the inflammatory mediators TNF-alpha, IL-6, IL-10, and IL-12p70. | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Human | Synovial tissue | NA | O00206.fasta | O00206 | 839 | It leads to the activationa and maturation of the dendritic cells | Cyokine assay | 16709864 | 2006 | Pubchem Assay |
| PRRID_0250 | Small Heat Shock Protein B8 (HSP22) Click for more detail | Host (Endogenous) (others) | MADGQMPFSCHYPSRLRRDPFRDSPLSSRLLDDGFGMDPFPDDLTASWPDWALPRLSSAWPGTLRSGMVPRGPTATARFGVPAEGRTPPPFPGEPWKVCVNVHSFKPEELMVKTKDGYVEVSGKHEEKQQEGGIVSKNFTKKIQLPAEVDPVTVFASLSPEGLLIIEAPQVPPYSTFGESSFNNELPQDSQEVTCT | 496 | Protein | Natural | It leads to the increased production of the inflammatory mediators TNF-alpha, IL-6, IL-10, and IL-12p70. | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Human | Synovial tissue | NA | O00206.fasta | O00206 | 839 | It leads to the activationa and maturation of the dendritic cells | Cyokine assay | 16709864 | 2006 | Pubchem Assay |
| PRRID_0260 | N-ALP1 Click for more detail | Mycoplasma pneumoniae (Bacteria) | NA | NA | Lipoprotein | Natural | It induces the activation of NF-kappaB and induces the expression levels of interleukin-6 (IL-6) and tumour necrosis factor-alpha (TNF-alpha). | Toll-like receptor 1/2 (TLR1/2) | Toll-like receptor (TLR) | Human | human kidney cell line, 293T | NA | NA | NA | NA | It has the role in immuno inflammation. | Transfection and luciferase assay | 17433078 | 2007 | NA |
| PRRID_0260 | N-ALP1 Click for more detail | Mycoplasma pneumoniae (Bacteria) | NA | NA | Lipoprotein | Natural | It induces the activation of NF-kappaB and induces the expression levels of interleukin-6 (IL-6) and tumour necrosis factor-alpha (TNF-alpha). | Toll-like receptor 1/2 (TLR1/2) | Toll-like receptor (TLR) | Human | human kidney cell line, 293T | NA | NA | NA | NA | It has the role in immuno inflammation. | Transfection and luciferase assay | 17433078 | 2007 | NA |
| PRRID_0261 | N-ALP2 Click for more detail | Mycoplasma pneumoniae (Bacteria) | NA | NA | Lipoprotein | Natural | It induces the activation of NF-kappaB and induces the expression levels of interleukin-6 (IL-6) and tumour necrosis factor-alpha (TNF-alpha). | Toll-like receptor 1/2 (TLR1/2) | Toll-like receptor (TLR) | Human | human kidney cell line, 293T | NA | NA | NA | NA | It has the role in immuno inflammation. | Transfection and luciferase assay | 17433078 | 2007 | NA |
| PRRID_0261 | N-ALP2 Click for more detail | Mycoplasma pneumoniae (Bacteria) | NA | NA | Lipoprotein | Natural | It induces the activation of NF-kappaB and induces the expression levels of interleukin-6 (IL-6) and tumour necrosis factor-alpha (TNF-alpha). | Toll-like receptor 1/2 (TLR1/2) | Toll-like receptor (TLR) | Human | human kidney cell line, 293T | NA | NA | NA | NA | It has the role in immuno inflammation. | Transfection and luciferase assay | 17433078 | 2007 | NA |
| PRRID_0263 | polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail | NA | C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O | NA | Nucleic Acid | Synthetic | elicit innate immune response | Toll-like receptor 3 (TLR3) | Toll-like receptor (TLR) | Human | macrophages and dendritic cells | NA | O15455.fasta | O15455 | 904 | Induces pro-inflammatory cytokine response | NA | 17573354 | 2007 | Pubchem Assay |
| PRRID_0263 | polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail | NA | C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O | NA | Nucleic Acid | Synthetic | elicit innate immune response | Toll-like receptor 3 (TLR3) | Toll-like receptor (TLR) | Human | macrophages and dendritic cells | NA | O15455.fasta | O15455 | 904 | Induces pro-inflammatory cytokine response | NA | 17573354 | 2007 | Pubchem Assay |
| PRRID_0266 | 3M-003 Click for more detail | NA | NA | NA | Nucleic Acid | Synthetic | Stimulation leads to the increased gene expression of cytokines and chemokines such as, IL-6, MIP1 alpha, MIP1 beta, TNF alpha, and LTA. | Toll-like receptor 7/8 (TLR7/8) | Toll-like receptor (TLR) | Human | B cells and pDC | NA | NA | NA | NA | It induces changes in gene expression and protein production that effect B cell function such as, Cell Migration, Signal Transduction, Proliferation, Differentiation and Survival. | ELISA | 18652679 | 2008 | NA |
| PRRID_0266 | 3M-003 Click for more detail | NA | NA | NA | Nucleic Acid | Synthetic | Stimulation leads to the increased gene expression of cytokines and chemokines such as, IL-6, MIP1 alpha, MIP1 beta, TNF alpha, and LTA. | Toll-like receptor 7/8 (TLR7/8) | Toll-like receptor (TLR) | Human | B cells and pDC | NA | NA | NA | NA | It induces changes in gene expression and protein production that effect B cell function such as, Cell Migration, Signal Transduction, Proliferation, Differentiation and Survival. | ELISA | 18652679 | 2008 | NA |
| PRRID_0268 | 852A Click for more detail | NA | CCCC=CC=CC(=O)NC(CC(=O)N)C(=O)NC(CC(=O)N)C(=O)NC(C1CCC(CC1)O)C(=O)NC(CCCN)C(=O)NC(C(C)O)C(=O)NC(C2CCC(CC2)O)C(=O)NC(C3CCC(CC3)O)C(=O)NC(C(C)O)C(=O)NC(CC4=CC=CC=C4)C(=O)NC(CCCN)C(=O)NC(C5CCC(CC5)O)C(=O)NC(C(C)O)C(=O)NC(C6CCC(CC6)O)C(=O)NCC(=O)NC(CC(C)C)C(=O)NC(C)C(=O)NC(C7CCC(C(C7)Cl)O)C(=O)O | NA | Nucleic Acid | Synthetic | It has stimulated the production of interferon-‚ç∫ (IFN-‚ç∫), IFN-inducible protein-10 (IP-10), interleukin-1 receptor antagonist (IL-1Ra), monocyte chemotactic protein-1 (MCP-1), and tumor necrosis factor-related apoptosis-inducing ligand (TRAIL),IL-12p70, IL-18, and IFN- | Toll-like receptor 7 (TLR7) | Toll-like receptor (TLR) | Human | Peripheral blood mononuclear cells (PBMC) | LRR | Q9NYK1.fasta | Q9NYK1 | 1049 | It has inhibited the proliferation of tumor cell lines Hs294T and 769-P. | ELISA | 18439103 | 2008 | Pubchem Assay |
| PRRID_0268 | 852A Click for more detail | NA | CCCC=CC=CC(=O)NC(CC(=O)N)C(=O)NC(CC(=O)N)C(=O)NC(C1CCC(CC1)O)C(=O)NC(CCCN)C(=O)NC(C(C)O)C(=O)NC(C2CCC(CC2)O)C(=O)NC(C3CCC(CC3)O)C(=O)NC(C(C)O)C(=O)NC(CC4=CC=CC=C4)C(=O)NC(CCCN)C(=O)NC(C5CCC(CC5)O)C(=O)NC(C(C)O)C(=O)NC(C6CCC(CC6)O)C(=O)NCC(=O)NC(CC(C)C)C(=O)NC(C)C(=O)NC(C7CCC(C(C7)Cl)O)C(=O)O | NA | Nucleic Acid | Synthetic | It has stimulated the production of interferon-‚ç∫ (IFN-‚ç∫), IFN-inducible protein-10 (IP-10), interleukin-1 receptor antagonist (IL-1Ra), monocyte chemotactic protein-1 (MCP-1), and tumor necrosis factor-related apoptosis-inducing ligand (TRAIL),IL-12p70, IL-18, and IFN- | Toll-like receptor 7 (TLR7) | Toll-like receptor (TLR) | Human | Peripheral blood mononuclear cells (PBMC) | LRR | Q9NYK1.fasta | Q9NYK1 | 1049 | It has inhibited the proliferation of tumor cell lines Hs294T and 769-P. | ELISA | 18439103 | 2008 | Pubchem Assay |
| PRRID_0269 | 852A Click for more detail | NA | CCCC=CC=CC(=O)NC(CC(=O)N)C(=O)NC(CC(=O)N)C(=O)NC(C1CCC(CC1)O)C(=O)NC(CCCN)C(=O)NC(C(C)O)C(=O)NC(C2CCC(CC2)O)C(=O)NC(C3CCC(CC3)O)C(=O)NC(C(C)O)C(=O)NC(CC4=CC=CC=C4)C(=O)NC(CCCN)C(=O)NC(C5CCC(CC5)O)C(=O)NC(C(C)O)C(=O)NC(C6CCC(CC6)O)C(=O)NCC(=O)NC(CC(C)C)C(=O)NC(C)C(=O)NC(C7CCC(C(C7)Cl)O)C(=O)O | NA | Nucleic Acid | Synthetic | Stimulation leads to the increased gene expression of cytokines and chemokines such as, IL-6, MIP1 alpha, MIP1 beta, TNF alpha, and LTA. | Toll-like receptor 7 (TLR7) | Toll-like receptor (TLR) | Human | B cells and pDC | NA | Q9NYK1.fasta | Q9NYK1 | 1049 | It induces changes in gene expression and protein production that effect B cell function such as, Cell Migration, Signal Transduction, Proliferation, Differentiation and Survival. | ELISA | 18652679 | 2008 | Pubchem Assay |
| PRRID_0269 | 852A Click for more detail | NA | CCCC=CC=CC(=O)NC(CC(=O)N)C(=O)NC(CC(=O)N)C(=O)NC(C1CCC(CC1)O)C(=O)NC(CCCN)C(=O)NC(C(C)O)C(=O)NC(C2CCC(CC2)O)C(=O)NC(C3CCC(CC3)O)C(=O)NC(C(C)O)C(=O)NC(CC4=CC=CC=C4)C(=O)NC(CCCN)C(=O)NC(C5CCC(CC5)O)C(=O)NC(C(C)O)C(=O)NC(C6CCC(CC6)O)C(=O)NCC(=O)NC(CC(C)C)C(=O)NC(C)C(=O)NC(C7CCC(C(C7)Cl)O)C(=O)O | NA | Nucleic Acid | Synthetic | Stimulation leads to the increased gene expression of cytokines and chemokines such as, IL-6, MIP1 alpha, MIP1 beta, TNF alpha, and LTA. | Toll-like receptor 7 (TLR7) | Toll-like receptor (TLR) | Human | B cells and pDC | NA | Q9NYK1.fasta | Q9NYK1 | 1049 | It induces changes in gene expression and protein production that effect B cell function such as, Cell Migration, Signal Transduction, Proliferation, Differentiation and Survival. | ELISA | 18652679 | 2008 | Pubchem Assay |
| PRRID_0271 | AM3 Click for more detail | Immunomodulatory drug (others) | NA | NA | Glycoconjugate | Synthetic | AM3 induces NF-kB activation, IkB-a degradation and MAPK phosphorylationand enhanced the expression of CD54, CD83, CD86, HLA-DR, chemokines and chemokine receptors, interleukin (IL)-12p70 and IL-10. | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Human | Monocytederived Dendritic cells (MDDCs) | LRR | O00206.fasta | O00206 | 839 | AM3 induces human MDDC maturation, enhance and activates the T-cell proliferation and promotes MDDC maturation in patients with chronic HCV infection. | ELISA | 18414382 | 2008 | Pubchem Assay |
| PRRID_0271 | AM3 Click for more detail | Immunomodulatory drug (others) | NA | NA | Glycoconjugate | Synthetic | AM3 induces NF-kB activation, IkB-a degradation and MAPK phosphorylationand enhanced the expression of CD54, CD83, CD86, HLA-DR, chemokines and chemokine receptors, interleukin (IL)-12p70 and IL-10. | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Human | Monocytederived Dendritic cells (MDDCs) | LRR | O00206.fasta | O00206 | 839 | AM3 induces human MDDC maturation, enhance and activates the T-cell proliferation and promotes MDDC maturation in patients with chronic HCV infection. | ELISA | 18414382 | 2008 | Pubchem Assay |
| PRRID_0274 | Cardioprotectant adenosine Click for more detail | NA | NA | NA | Nucleic Acid | Natural | Adenosine increases matrix metalloproteinase-9 production by primary macrophages from healthy volunteers and myocardial infarction patients. | Adenosine-A3 receptor | G-protein-coupled receptors (GPCR) | Human | PBMCs | NA | P0DMS8.fasta | P0DMS8 | 318 | It improves the revascularization. | ELISA | 18653544 | 2008 | Pubchem Assay |
| PRRID_0274 | Cardioprotectant adenosine Click for more detail | NA | NA | NA | Nucleic Acid | Natural | Adenosine increases matrix metalloproteinase-9 production by primary macrophages from healthy volunteers and myocardial infarction patients. | Adenosine-A3 receptor | G-protein-coupled receptors (GPCR) | Human | PBMCs | NA | P0DMS8.fasta | P0DMS8 | 318 | It improves the revascularization. | ELISA | 18653544 | 2008 | Pubchem Assay |
| PRRID_0275 | Chlamydia trachomatis Click for more detail | Chlamydia trachomatis(Bacteria) | NA | NA | Whole organism | Natural | Chlamydia trachomatis infection leads to up-regulation of inflammatory IL-8. | Nucleotide Binding Oligomerization Domain Containing 1 (Nod1) | NOD-like receptor (NLR) | Human | HeLa 229 epithelial cells | LRR | Q9Y239.fasta | Q9Y239 | 953 | NOD1 and RIP2 activation is needed for the IL-8 response to C. trachomatis infection. | ELISA | 18426885 | 2008 | Pubchem Assay |
| PRRID_0275 | Chlamydia trachomatis Click for more detail | Chlamydia trachomatis(Bacteria) | NA | NA | Whole organism | Natural | Chlamydia trachomatis infection leads to up-regulation of inflammatory IL-8. | Nucleotide Binding Oligomerization Domain Containing 1 (Nod1) | NOD-like receptor (NLR) | Human | HeLa 229 epithelial cells | LRR | Q9Y239.fasta | Q9Y239 | 953 | NOD1 and RIP2 activation is needed for the IL-8 response to C. trachomatis infection. | ELISA | 18426885 | 2008 | Pubchem Assay |
| PRRID_0279 | CpG2006 Click for more detail | NA | 5’-tcgtcgttttgtcgttttgtcgtt-3’ | 24 | Nucleic Acid | Synthetic | Stimulation leads to the increased gene expression of cytokines and chemokines such as, IL-6, MIP1 alpha, MIP1 beta, TNF alpha, and LTA. | Toll-like receptor 9 (TLR9) | Toll-like receptor (TLR) | Human | B cells and pDC | NA | Q9NR96.fasta | Q9NR96 | 1032 | It induces changes in gene expression and protein production that effect B cell function such as, Cell Migration, Signal Transduction, Proliferation, Differentiation and Survival. | ELISA | 18652679 | 2008 | Pubchem Assay |
| PRRID_0279 | CpG2006 Click for more detail | NA | 5’-tcgtcgttttgtcgttttgtcgtt-3’ | 24 | Nucleic Acid | Synthetic | Stimulation leads to the increased gene expression of cytokines and chemokines such as, IL-6, MIP1 alpha, MIP1 beta, TNF alpha, and LTA. | Toll-like receptor 9 (TLR9) | Toll-like receptor (TLR) | Human | B cells and pDC | NA | Q9NR96.fasta | Q9NR96 | 1032 | It induces changes in gene expression and protein production that effect B cell function such as, Cell Migration, Signal Transduction, Proliferation, Differentiation and Survival. | ELISA | 18652679 | 2008 | Pubchem Assay |
| PRRID_0280 | Curdlan Click for more detail | Alcaligenes faecalis(Bacteria) | C(C1C(C(C(C(O1)O)O)O)O)O | NA | Glucan | Natural | Curdlan is a pure dectin-1 agonist and induces TNF-alpha production in human PBMCs and macrophages. | Dectin-1 | C type Lectin (CTL/CLR) | Human | PBMCs and monocyte-derived macrophages. | NA | Q9BXN2.fasta | Q9BXN2 | 247 | It is resoonsible for the immuno-inflammation in the host cell. | ELISA | 18549457 | 2008 | Pubchem Assay |
| PRRID_0280 | Curdlan Click for more detail | Alcaligenes faecalis(Bacteria) | C(C1C(C(C(C(O1)O)O)O)O)O | NA | Glucan | Natural | Curdlan is a pure dectin-1 agonist and induces TNF-alpha production in human PBMCs and macrophages. | Dectin-1 | C type Lectin (CTL/CLR) | Human | PBMCs and monocyte-derived macrophages. | NA | Q9BXN2.fasta | Q9BXN2 | 247 | It is resoonsible for the immuno-inflammation in the host cell. | ELISA | 18549457 | 2008 | Pubchem Assay |
| PRRID_0281 | dsRNA Click for more detail | Virus | NA | NA | Nucleic Acid | Natural | initiate intracellular signaling cascades that may lead to host inflammation. | Toll-like receptor 3 (TLR3) | Toll-like receptor (TLR) | Human | basal epithelial layer. | Leucine-rich Repeat (LRR) Domain | O15455.fasta | O15455 | 904 | NA | immunohistochemistry | 18793367 | 2008 | Pubchem Assay |
| PRRID_0281 | dsRNA Click for more detail | Virus | NA | NA | Nucleic Acid | Natural | initiate intracellular signaling cascades that may lead to host inflammation. | Toll-like receptor 3 (TLR3) | Toll-like receptor (TLR) | Human | basal epithelial layer. | Leucine-rich Repeat (LRR) Domain | O15455.fasta | O15455 | 904 | NA | immunohistochemistry | 18793367 | 2008 | Pubchem Assay |
| PRRID_0287 | FTT1103 Click for more detail | Mycoplasma pneumoniae (Bacteria) | NA | NA | Lipoprotein | Natural | Immunostimulant | Toll-like receptor 2 (TLR2)/Toll-like receptor (TLR1 | Toll-like receptor (TLR) | Human | NA | NA | NA | NA | NA | capable of stimulating a proinflammatory response and the cellular receptors they trigger | NA | 18079113 | 2008 | NA |
| PRRID_0287 | FTT1103 Click for more detail | Mycoplasma pneumoniae (Bacteria) | NA | NA | Lipoprotein | Natural | Immunostimulant | Toll-like receptor 2 (TLR2)/Toll-like receptor (TLR1 | Toll-like receptor (TLR) | Human | NA | NA | NA | NA | NA | capable of stimulating a proinflammatory response and the cellular receptors they trigger | NA | 18079113 | 2008 | NA |
| PRRID_0291 | German Cockroach frass Click for more detail | German Cockroach (others) | NA | NA | Allergen | Natural | It induced NF-κB translocation and DNA binding, which leads to the secretions of cytokines, such as TNF-⍺ and IL-8. | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Human | Primary human neutrophils | LRR | O60603.fasta | O60603 | 784 | It is responisble for the immune response against the allergen having origin as German Cockroach frass. | ELISA | 18424755 | 2008 | Pubchem Assay |
| PRRID_0291 | German Cockroach frass Click for more detail | German Cockroach (others) | NA | NA | Allergen | Natural | It induced NF-κB translocation and DNA binding, which leads to the secretions of cytokines, such as TNF-⍺ and IL-8. | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Human | Primary human neutrophils | LRR | O60603.fasta | O60603 | 784 | It is responisble for the immune response against the allergen having origin as German Cockroach frass. | ELISA | 18424755 | 2008 | Pubchem Assay |
| PRRID_0293 | Hantaan virus (HTNV) Click for more detail | Hantaan virus (HTNV) (Virus) | NA | NA | Whole organism | Natural | HTNV infection induces IFN-β, IL-6 and TNF-α expression. | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Human | Endothelial vein cells (EVC-304) | LRR | O00206.fasta | O00206 | 839 | TLR4 is a potential factor in HFRS pathogenesis. | ELISA | 18707748 | 2008 | Pubchem Assay |
| PRRID_0293 | Hantaan virus (HTNV) Click for more detail | Hantaan virus (HTNV) (Virus) | NA | NA | Whole organism | Natural | HTNV infection induces IFN-β, IL-6 and TNF-α expression. | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Human | Endothelial vein cells (EVC-304) | LRR | O00206.fasta | O00206 | 839 | TLR4 is a potential factor in HFRS pathogenesis. | ELISA | 18707748 | 2008 | Pubchem Assay |
| PRRID_0298 | Imiquimod Click for more detail | NA | CC(C)CN1C=NC2=C1C3=CC=CC=C3N=C2N | NA | Nucleic Acid | Synthetic | imiquimod leads to decreased tyrosinase and MITF expression and is accompanied by decreased pigmentation. | Toll-like receptor 7 (TLR7) | Toll-like receptor (TLR) | Human | Melanocytes | NA | Q9NYK1.fasta | Q9NYK1 | 1049 | It inhibits Melanogenesis and Proliferation of Human Melanocytes. | NA | 18596825 | 2008 | Pubchem Assay |
| PRRID_0298 | Imiquimod Click for more detail | NA | CC(C)CN1C=NC2=C1C3=CC=CC=C3N=C2N | NA | Nucleic Acid | Synthetic | imiquimod leads to decreased tyrosinase and MITF expression and is accompanied by decreased pigmentation. | Toll-like receptor 7 (TLR7) | Toll-like receptor (TLR) | Human | Melanocytes | NA | Q9NYK1.fasta | Q9NYK1 | 1049 | It inhibits Melanogenesis and Proliferation of Human Melanocytes. | NA | 18596825 | 2008 | Pubchem Assay |
| PRRID_0302 | Lipid A Click for more detail | Burkholderia pseudomallei(Bacteria) | CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC | NA | Lipid | Natural | Stimulation via LPS leads to the activation of NF-KappaB, which resulted into the production of TNF-α, MIP-2, and IL-10. | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Human | HEK293 cells | LRR | O00206.fasta | O00206 | 839 | It has a immunostimulatory role | ELISA | 18691413 | 2008 | Pubchem Assay |
| PRRID_0302 | Lipid A Click for more detail | Burkholderia pseudomallei(Bacteria) | CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC | NA | Lipid | Natural | Stimulation via LPS leads to the activation of NF-KappaB, which resulted into the production of TNF-α, MIP-2, and IL-10. | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Human | HEK293 cells | LRR | O00206.fasta | O00206 | 839 | It has a immunostimulatory role | ELISA | 18691413 | 2008 | Pubchem Assay |
| PRRID_0305 | Lipopolysaccharide (LPS) Click for more detail | E. coli 055:B5(Bacteria) | CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC | NA | Lipopolysaccharide (LPS) | Natural | LPS promotes TGFb1 and VEGF production in human prostate epithelial PC3 cells and also LPS stimulation, leads to the increased expression of NF-KB p65 protein. | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Human | Human prostate epithelial PC3 cells | LRR | O00206.fasta | O00206 | 839 | It plays important roles in promoting prostate cancer immune escape, survival, progression, and metastasis by inducing immunosuppressive and proangiogenic cytokines. | ELISA | 18649875 | 2008 | Pubchem Assay |
| PRRID_0305 | Lipopolysaccharide (LPS) Click for more detail | E. coli 055:B5(Bacteria) | CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC | NA | Lipopolysaccharide (LPS) | Natural | LPS promotes TGFb1 and VEGF production in human prostate epithelial PC3 cells and also LPS stimulation, leads to the increased expression of NF-KB p65 protein. | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Human | Human prostate epithelial PC3 cells | LRR | O00206.fasta | O00206 | 839 | It plays important roles in promoting prostate cancer immune escape, survival, progression, and metastasis by inducing immunosuppressive and proangiogenic cytokines. | ELISA | 18649875 | 2008 | Pubchem Assay |
| PRRID_0308 | Lipopolysaccharide (LPS) Click for more detail | Burkholderia pseudomallei(Bacteria) | CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC | NA | Lipopolysaccharide (LPS) | Natural | Stimulation via LPS leads to the activation of NF-KappaB, which resulted into the production of TNF-α, MIP-2, and IL-10. | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Human | HEK293 cells | LRR | O00206.fasta | O00206 | 839 | It has a immunostimulatory role | ELISA | 18691413 | 2008 | Pubchem Assay |
| PRRID_0308 | Lipopolysaccharide (LPS) Click for more detail | Burkholderia pseudomallei(Bacteria) | CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC | NA | Lipopolysaccharide (LPS) | Natural | Stimulation via LPS leads to the activation of NF-KappaB, which resulted into the production of TNF-α, MIP-2, and IL-10. | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Human | HEK293 cells | LRR | O00206.fasta | O00206 | 839 | It has a immunostimulatory role | ELISA | 18691413 | 2008 | Pubchem Assay |
| PRRID_0311 | Lipoprotein Click for more detail | Ureaplasma parvum (Bacteria) | NA | NA | Lipoprotein | Natural | Upon ligand engagement TLR proteins trigger downstream cellular signaling, leads to the activation of NF- | Toll-like receptor 1 (TLR1) | Toll-like receptor (TLR) | Human | Kidney cell line, 293T | LRR | Q15399.fasta | Q15399 | 786 | This induces the inflammatory response. | ELISA | 18451040 | 2008 | Pubchem Assay |
| PRRID_0311 | Lipoprotein Click for more detail | Ureaplasma parvum (Bacteria) | NA | NA | Lipoprotein | Natural | Upon ligand engagement TLR proteins trigger downstream cellular signaling, leads to the activation of NF- | Toll-like receptor 1 (TLR1) | Toll-like receptor (TLR) | Human | Kidney cell line, 293T | LRR | Q15399.fasta | Q15399 | 786 | This induces the inflammatory response. | ELISA | 18451040 | 2008 | Pubchem Assay |
| PRRID_0312 | Lipoprotein Click for more detail | Ureaplasma parvum (Bacteria) | NA | NA | Lipoprotein | Natural | Upon ligand engagement TLR proteins trigger downstream cellular signaling, leads to the activation of NF- | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Human | Kidney cell line, 293T | LRR | O60603.fasta | O60603 | 784 | This induces the inflammatory response. | ELISA | 18451040 | 2008 | Pubchem Assay |
| PRRID_0312 | Lipoprotein Click for more detail | Ureaplasma parvum (Bacteria) | NA | NA | Lipoprotein | Natural | Upon ligand engagement TLR proteins trigger downstream cellular signaling, leads to the activation of NF- | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Human | Kidney cell line, 293T | LRR | O60603.fasta | O60603 | 784 | This induces the inflammatory response. | ELISA | 18451040 | 2008 | Pubchem Assay |
| PRRID_0313 | Lipoprotein Click for more detail | Ureaplasma parvum (Bacteria) | NA | NA | Lipoprotein | Natural | Upon ligand engagement TLR proteins trigger downstream cellular signaling, leads to the activation of NF- | Toll-like receptor 6 (TLR6) | Toll-like receptor (TLR) | Human | Kidney cell line, 293T | LRR | Q9Y2C9.fasta | Q9Y2C9 | 796 | This induces the inflammatory response. | ELISA | 18451040 | 2008 | Pubchem Assay |
| PRRID_0313 | Lipoprotein Click for more detail | Ureaplasma parvum (Bacteria) | NA | NA | Lipoprotein | Natural | Upon ligand engagement TLR proteins trigger downstream cellular signaling, leads to the activation of NF- | Toll-like receptor 6 (TLR6) | Toll-like receptor (TLR) | Human | Kidney cell line, 293T | LRR | Q9Y2C9.fasta | Q9Y2C9 | 796 | This induces the inflammatory response. | ELISA | 18451040 | 2008 | Pubchem Assay |
| PRRID_0316 | Lipoteichoic Acid (LTA) Click for more detail | Bacillus subtilis(Bacteria) | C(C1C(C(C(C(O1)OCC(CO)O)OC2C(C(C(C(O2)COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(CO)O)O)O)O)O)O)O)O)O)O | NA | Amphiphile | Natural | LTA-treated LEC increases the expression of E-selectin, ICAM-1, and VCAM-1, moreover it induces the expression of CCL2, CCL5, and CCL20 (Cys-Cys motif chemokines) and of CXCL1, CXCL3, CXCL5, CXCL6, and CXCL8 (Cys-X-Cys motif chemokines). | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Human | Cultured human lymphatic endothelium (LEC) | LRR | O60603.fasta | O60603 | 784 | It has a immunostimulatory role | ELISA | 18523807 | 2008 | Pubchem Assay |
| PRRID_0316 | Lipoteichoic Acid (LTA) Click for more detail | Bacillus subtilis(Bacteria) | C(C1C(C(C(C(O1)OCC(CO)O)OC2C(C(C(C(O2)COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(CO)O)O)O)O)O)O)O)O)O)O | NA | Amphiphile | Natural | LTA-treated LEC increases the expression of E-selectin, ICAM-1, and VCAM-1, moreover it induces the expression of CCL2, CCL5, and CCL20 (Cys-Cys motif chemokines) and of CXCL1, CXCL3, CXCL5, CXCL6, and CXCL8 (Cys-X-Cys motif chemokines). | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Human | Cultured human lymphatic endothelium (LEC) | LRR | O60603.fasta | O60603 | 784 | It has a immunostimulatory role | ELISA | 18523807 | 2008 | Pubchem Assay |
| PRRID_0320 | Low Molecular Weight Hyaluronic Acid (LMW-HA) Click for more detail | Host (Endogenous) (others) | CC(=O)NC1CC(C(OC1OC2C(C(C(OC2C(=O)[O-])O)O)O)CO)O | NA | Glycosaminoglycan | Natural | It leads to the production of antimicrobial peptide beta defensins 2. | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Human | Keratinocytes NCTC 2544 cell line | NA | O60603.fasta | O60603 | 784 | It leadsto the induction of an antibacterial response. | ELISA | 18641349 | 2008 | Pubchem Assay |
| PRRID_0320 | Low Molecular Weight Hyaluronic Acid (LMW-HA) Click for more detail | Host (Endogenous) (others) | CC(=O)NC1CC(C(OC1OC2C(C(C(OC2C(=O)[O-])O)O)O)CO)O | NA | Glycosaminoglycan | Natural | It leads to the production of antimicrobial peptide beta defensins 2. | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Human | Keratinocytes NCTC 2544 cell line | NA | O60603.fasta | O60603 | 784 | It leadsto the induction of an antibacterial response. | ELISA | 18641349 | 2008 | Pubchem Assay |
| PRRID_0321 | Low Molecular Weight Hyaluronic Acid (LMW-HA) Click for more detail | Host (Endogenous) (others) | CC(=O)NC1CC(C(OC1OC2C(C(C(OC2C(=O)[O-])O)O)O)CO)O | NA | Glycosaminoglycan | Natural | It leads to the production of antimicrobial peptide beta defensins 2. | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Human | Keratinocytes NCTC 2544 cell line | NA | O00206.fasta | O00206 | 839 | It leadsto the induction of an antibacterial response. | ELISA | 18641349 | 2008 | Pubchem Assay |
| PRRID_0321 | Low Molecular Weight Hyaluronic Acid (LMW-HA) Click for more detail | Host (Endogenous) (others) | CC(=O)NC1CC(C(OC1OC2C(C(C(OC2C(=O)[O-])O)O)O)CO)O | NA | Glycosaminoglycan | Natural | It leads to the production of antimicrobial peptide beta defensins 2. | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Human | Keratinocytes NCTC 2544 cell line | NA | O00206.fasta | O00206 | 839 | It leadsto the induction of an antibacterial response. | ELISA | 18641349 | 2008 | Pubchem Assay |
| PRRID_0322 | Low Molecular Weight Hyaluronic Acid (LMW-HA) Click for more detail | Host (Endogenous) (others) | CC(=O)NC1CC(C(OC1OC2C(C(C(OC2C(=O)[O-])O)O)O)CO)O | NA | Glycosaminoglycan | Natural | It leads to the production of antimicrobial peptide beta defensins 2. | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Human | Dorsal skin | NA | O00206.fasta | O00206 | 839 | It leadsto the induction of an antibacterial response. | ELISA | 18641349 | 2008 | Pubchem Assay |
| PRRID_0322 | Low Molecular Weight Hyaluronic Acid (LMW-HA) Click for more detail | Host (Endogenous) (others) | CC(=O)NC1CC(C(OC1OC2C(C(C(OC2C(=O)[O-])O)O)O)CO)O | NA | Glycosaminoglycan | Natural | It leads to the production of antimicrobial peptide beta defensins 2. | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Human | Dorsal skin | NA | O00206.fasta | O00206 | 839 | It leadsto the induction of an antibacterial response. | ELISA | 18641349 | 2008 | Pubchem Assay |
| PRRID_0327 | MG149 Click for more detail | Mycoplasma genitalium (Bacteria) | CCCCCCCC1=CC=C(C=C1)CCC2=C(C(=CC=C2)O)C(=O)O | NA | Lipoprotein | Natural | On binding to the TLR2, it induces the activation of NF- | Toll-like receptor (TLR1 and Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Human | Kidney cell line, 293T | LRR | NA | NA | NA | It has a immunostimulatory role | ELISA | 18474641 | 2008 | NA |
| PRRID_0327 | MG149 Click for more detail | Mycoplasma genitalium (Bacteria) | CCCCCCCC1=CC=C(C=C1)CCC2=C(C(=CC=C2)O)C(=O)O | NA | Lipoprotein | Natural | On binding to the TLR2, it induces the activation of NF- | Toll-like receptor (TLR1 and Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Human | Kidney cell line, 293T | LRR | NA | NA | NA | It has a immunostimulatory role | ELISA | 18474641 | 2008 | NA |
| PRRID_0338 | polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail | NA | C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O | NA | Nucleic Acid | Synthetic | Stilmulation leads to the activation of the NF-KappaB. | Toll-like receptor 3 (TLR3) | Toll-like receptor (TLR) | Human | Primary Human Keratinocytes | NA | O15455.fasta | O15455 | 904 | It is responsible for the antiviral defense status. | ELISA | 18684960 | 2008 | Pubchem Assay |
| PRRID_0338 | polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail | NA | C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O | NA | Nucleic Acid | Synthetic | Stilmulation leads to the activation of the NF-KappaB. | Toll-like receptor 3 (TLR3) | Toll-like receptor (TLR) | Human | Primary Human Keratinocytes | NA | O15455.fasta | O15455 | 904 | It is responsible for the antiviral defense status. | ELISA | 18684960 | 2008 | Pubchem Assay |
| PRRID_0339 | polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail | NA | C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O | NA | Nucleic Acid | Synthetic | Stilmulation leads to the activation of the IRF3. | Protein Kinase R (PKR) | Cytosolic receptor | Human | Primary Human Keratinocytes | NA | NA | NA | NA | It is responsible for the antiviral defense status. | ELISA | 18684960 | 2008 | NA |
| PRRID_0339 | polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail | NA | C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O | NA | Nucleic Acid | Synthetic | Stilmulation leads to the activation of the IRF3. | Protein Kinase R (PKR) | Cytosolic receptor | Human | Primary Human Keratinocytes | NA | NA | NA | NA | It is responsible for the antiviral defense status. | ELISA | 18684960 | 2008 | NA |
| PRRID_0340 | polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail | NA | C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O | NA | Nucleic Acid | Synthetic | Stilmulation leads to the activation of the IRF3. | RIG-1 | Rig-like receptor (RLR) | Human | Primary Human Keratinocytes | NA | O95786.fasta | O95786 | 925 | It is responsible for the antiviral defense status. | ELISA | 18684960 | 2008 | Pubchem Assay |
| PRRID_0340 | polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail | NA | C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O | NA | Nucleic Acid | Synthetic | Stilmulation leads to the activation of the IRF3. | RIG-1 | Rig-like receptor (RLR) | Human | Primary Human Keratinocytes | NA | O95786.fasta | O95786 | 925 | It is responsible for the antiviral defense status. | ELISA | 18684960 | 2008 | Pubchem Assay |
| PRRID_0341 | polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail | NA | C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O | NA | Nucleic Acid | Synthetic | Stilmulation leads to the activation of the IRF3 and NF- | MDA5 | Rig-like receptor (RLR) | Human | Primary Human Keratinocytes | NA | Q53TB6.fasta | Q53TB6 | 435 | It is responsible for the antiviral defense status. | ELISA | 18684960 | 2008 | Pubchem Assay |
| PRRID_0341 | polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail | NA | C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O | NA | Nucleic Acid | Synthetic | Stilmulation leads to the activation of the IRF3 and NF- | MDA5 | Rig-like receptor (RLR) | Human | Primary Human Keratinocytes | NA | Q53TB6.fasta | Q53TB6 | 435 | It is responsible for the antiviral defense status. | ELISA | 18684960 | 2008 | Pubchem Assay |
| PRRID_0342 | polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail | NA | C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O | NA | Nucleic Acid | Synthetic | Poly(I:C) stimulate the secretion of cytokines and chemokines such as, IL-6, RANTES/CCL5 and MCP-1/CCL2. | Toll-like receptor 3 (TLR3) | Toll-like receptor (TLR) | Human | Mesothelial cells | NA | O15455.fasta | O15455 | 904 | It leads to the inflammation and infection of mesothelial cells. | ELISA | 19005739 | 2008 | Pubchem Assay |
| PRRID_0342 | polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail | NA | C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O | NA | Nucleic Acid | Synthetic | Poly(I:C) stimulate the secretion of cytokines and chemokines such as, IL-6, RANTES/CCL5 and MCP-1/CCL2. | Toll-like receptor 3 (TLR3) | Toll-like receptor (TLR) | Human | Mesothelial cells | NA | O15455.fasta | O15455 | 904 | It leads to the inflammation and infection of mesothelial cells. | ELISA | 19005739 | 2008 | Pubchem Assay |
| PRRID_0343 | polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail | NA | C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O | NA | Nucleic Acid | Synthetic | Poly(I:C) stimulate the secretion of cytokines and chemokines such as, IL-6, RANTES/CCL5 and MCP-1/CCL2. | RIG-1 | Rig-like receptor (RLR) | Human | Mesothelial cells | NA | O95786.fasta | O95786 | 925 | It leads to the inflammation and infection of mesothelial cells. | ELISA | 19005739 | 2008 | Pubchem Assay |
| PRRID_0343 | polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail | NA | C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O | NA | Nucleic Acid | Synthetic | Poly(I:C) stimulate the secretion of cytokines and chemokines such as, IL-6, RANTES/CCL5 and MCP-1/CCL2. | RIG-1 | Rig-like receptor (RLR) | Human | Mesothelial cells | NA | O95786.fasta | O95786 | 925 | It leads to the inflammation and infection of mesothelial cells. | ELISA | 19005739 | 2008 | Pubchem Assay |
| PRRID_0344 | polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail | NA | C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O | NA | Nucleic Acid | Synthetic | Poly(I:C) stimulate the secretion of cytokines and chemokines such as, IL-6, RANTES/CCL5 and MCP-1/CCL2. | MDA5 | Rig-like receptor (RLR) | Human | Mesothelial cells | NA | Q53TB6.fasta | Q53TB6 | 435 | It leads to the inflammation and infection of mesothelial cells. | ELISA | 19005739 | 2008 | Pubchem Assay |
| PRRID_0344 | polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail | NA | C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O | NA | Nucleic Acid | Synthetic | Poly(I:C) stimulate the secretion of cytokines and chemokines such as, IL-6, RANTES/CCL5 and MCP-1/CCL2. | MDA5 | Rig-like receptor (RLR) | Human | Mesothelial cells | NA | Q53TB6.fasta | Q53TB6 | 435 | It leads to the inflammation and infection of mesothelial cells. | ELISA | 19005739 | 2008 | Pubchem Assay |
| PRRID_0345 | SalP Click for more detail | Bacteria | NA | NA | Lipoprotein | Natural | Immunostimulant | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Human | human corneal epithelial | NA | O60603.fasta | O60603 | 784 | NA | Western Blot analysis | 18191935 | 2008 | Pubchem Assay |
| PRRID_0345 | SalP Click for more detail | Bacteria | NA | NA | Lipoprotein | Natural | Immunostimulant | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Human | human corneal epithelial | NA | O60603.fasta | O60603 | 784 | NA | Western Blot analysis | 18191935 | 2008 | Pubchem Assay |
| PRRID_0346 | single-stranded RNA Click for more detail | Virus | NA | NA | Nucleic Acid | Natural | initiate intracellular signaling cascades that may lead to host inflammation. | Toll-like receptor 7 (TLR7) | Toll-like receptor (TLR) | Human | epithelial cells | Leucine-rich Repeat (LRR) Domain | Q9NYK1.fasta | Q9NYK1 | 1049 | NA | immunohistochemistry | 18793367 | 2008 | Pubchem Assay |
| PRRID_0346 | single-stranded RNA Click for more detail | Virus | NA | NA | Nucleic Acid | Natural | initiate intracellular signaling cascades that may lead to host inflammation. | Toll-like receptor 7 (TLR7) | Toll-like receptor (TLR) | Human | epithelial cells | Leucine-rich Repeat (LRR) Domain | Q9NYK1.fasta | Q9NYK1 | 1049 | NA | immunohistochemistry | 18793367 | 2008 | Pubchem Assay |
| PRRID_0347 | single-stranded RNA Click for more detail | Virus | NA | NA | Nucleic Acid | Natural | initiate intracellular signaling cascades that may lead to host inflammation. | Toll-like receptor 8 (TLR8) | Toll-like receptor (TLR) | Human | epithelial cells | Leucine-rich Repeat (LRR) Domain | Q9NR97.fasta | Q9NR97 | 1041 | NA | immunohistochemistry | 18793367 | 2008 | Pubchem Assay |
| PRRID_0347 | single-stranded RNA Click for more detail | Virus | NA | NA | Nucleic Acid | Natural | initiate intracellular signaling cascades that may lead to host inflammation. | Toll-like receptor 8 (TLR8) | Toll-like receptor (TLR) | Human | epithelial cells | Leucine-rich Repeat (LRR) Domain | Q9NR97.fasta | Q9NR97 | 1041 | NA | immunohistochemistry | 18793367 | 2008 | Pubchem Assay |
| PRRID_0349 | Staphylococcus aureus Click for more detail | S. aureus (Bacteria) | NA | NA | Whole organism | Natural | S. aureus induces IL-8 and TNF-alpha release by CBMC. | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Human | Cord Blood-Derived Mast Cells (CBMC) | NA | O60603.fasta | O60603 | 784 | S. aureus adheres to, invades, survives in, and stimulates human mast cells with the involvement of CD48 and TLR2. | ELISA | 18644875 | 2008 | Pubchem Assay |
| PRRID_0349 | Staphylococcus aureus Click for more detail | S. aureus (Bacteria) | NA | NA | Whole organism | Natural | S. aureus induces IL-8 and TNF-alpha release by CBMC. | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Human | Cord Blood-Derived Mast Cells (CBMC) | NA | O60603.fasta | O60603 | 784 | S. aureus adheres to, invades, survives in, and stimulates human mast cells with the involvement of CD48 and TLR2. | ELISA | 18644875 | 2008 | Pubchem Assay |
| PRRID_0351 | TUL4 Click for more detail | Mycoplasma pneumoniae (Bacteria) | NA | NA | Lipoprotein | Natural | Immunostimulant | Toll-like receptor 2 (TLR2)/Toll-like receptor (TLR1 | Toll-like receptor (TLR) | Human | NA | NA | NA | NA | NA | capable of stimulating a proinflammatory response and the cellular receptors they trigger | NA | 18079113 | 2008 | NA |
| PRRID_0351 | TUL4 Click for more detail | Mycoplasma pneumoniae (Bacteria) | NA | NA | Lipoprotein | Natural | Immunostimulant | Toll-like receptor 2 (TLR2)/Toll-like receptor (TLR1 | Toll-like receptor (TLR) | Human | NA | NA | NA | NA | NA | capable of stimulating a proinflammatory response and the cellular receptors they trigger | NA | 18079113 | 2008 | NA |
| PRRID_0353 | Unmethylated CpG DNA Click for more detail | Bacteria | NA | NA | NA | Natural | initiate intracellular signaling cascades that may lead to host inflammation. | Toll-like receptor 9 (TLR9) | Toll-like receptor (TLR) | Human | basal epithelial layer. | Leucine-rich Repeat (LRR) Domain | Q9NR96.fasta | Q9NR96 | 1032 | NA | immunohistochemistry | 18793367 | 2008 | Pubchem Assay |
| PRRID_0353 | Unmethylated CpG DNA Click for more detail | Bacteria | NA | NA | NA | Natural | initiate intracellular signaling cascades that may lead to host inflammation. | Toll-like receptor 9 (TLR9) | Toll-like receptor (TLR) | Human | basal epithelial layer. | Leucine-rich Repeat (LRR) Domain | Q9NR96.fasta | Q9NR96 | 1032 | NA | immunohistochemistry | 18793367 | 2008 | Pubchem Assay |
| PRRID_0371 | Lipoteichoic Acid (LTA) Click for more detail | S. aureus (Bacteria) | C(C1C(C(C(C(O1)OCC(CO)O)OC2C(C(C(C(O2)COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(CO)O)O)O)O)O)O)O)O)O)O | NA | Amphiphile | Natural | It induces the production of the pro-inflammatory cytokines such as TNF-alpha and CXCL8. | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Human | Odontoblasts | LRR | O60603.fasta | O60603 | 784 | It has inflammatory/immune response agianst gram-positive bacteria. | ELISA | 19250704 | 2009 | Pubchem Assay |
| PRRID_0371 | Lipoteichoic Acid (LTA) Click for more detail | S. aureus (Bacteria) | C(C1C(C(C(C(O1)OCC(CO)O)OC2C(C(C(C(O2)COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(CO)O)O)O)O)O)O)O)O)O)O | NA | Amphiphile | Natural | It induces the production of the pro-inflammatory cytokines such as TNF-alpha and CXCL8. | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Human | Odontoblasts | LRR | O60603.fasta | O60603 | 784 | It has inflammatory/immune response agianst gram-positive bacteria. | ELISA | 19250704 | 2009 | Pubchem Assay |
| PRRID_0372 | Lipoteichoic Acid (LTA) Click for more detail | S. aureus (Bacteria) | C(C1C(C(C(C(O1)OCC(CO)O)OC2C(C(C(C(O2)COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(CO)O)O)O)O)O)O)O)O)O)O | NA | Amphiphile | Natural | It induces the production of the pro-inflammatory cytokines such as TNF-alpha and CXCL8. | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Human | Dental pulp fibroblasts | LRR | O60603.fasta | O60603 | 784 | It has inflammatory/immune response agianst gram-positive bacteria. | ELISA | 19250704 | 2009 | Pubchem Assay |
| PRRID_0372 | Lipoteichoic Acid (LTA) Click for more detail | S. aureus (Bacteria) | C(C1C(C(C(C(O1)OCC(CO)O)OC2C(C(C(C(O2)COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(CO)O)O)O)O)O)O)O)O)O)O | NA | Amphiphile | Natural | It induces the production of the pro-inflammatory cytokines such as TNF-alpha and CXCL8. | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Human | Dental pulp fibroblasts | LRR | O60603.fasta | O60603 | 784 | It has inflammatory/immune response agianst gram-positive bacteria. | ELISA | 19250704 | 2009 | Pubchem Assay |
| PRRID_0373 | Lipoteichoic Acid (LTA) Click for more detail | S. aureus (Bacteria) | C(C1C(C(C(C(O1)OCC(CO)O)OC2C(C(C(C(O2)COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(CO)O)O)O)O)O)O)O)O)O)O | NA | Amphiphile | Natural | It induces the production of the pro-inflammatory cytokines such as TNF-alpha, IL-1beta and CXCL8. | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Human | Immature dendritic cells | LRR | O60603.fasta | O60603 | 784 | It has inflammatory/immune response agianst gram-positive bacteria. | ELISA | 19250704 | 2009 | Pubchem Assay |
| PRRID_0373 | Lipoteichoic Acid (LTA) Click for more detail | S. aureus (Bacteria) | C(C1C(C(C(C(O1)OCC(CO)O)OC2C(C(C(C(O2)COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(CO)O)O)O)O)O)O)O)O)O)O | NA | Amphiphile | Natural | It induces the production of the pro-inflammatory cytokines such as TNF-alpha, IL-1beta and CXCL8. | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Human | Immature dendritic cells | LRR | O60603.fasta | O60603 | 784 | It has inflammatory/immune response agianst gram-positive bacteria. | ELISA | 19250704 | 2009 | Pubchem Assay |
| PRRID_0375 | MALP-2 (macrophage-activating lipopeptide 2) Click for more detail | NA | C1=CC=C2C(=C1)C(=CN2)CC(C(=O)O)NC(=O)CCC(C(=O)O)N | NA | Lipopeptides | Natural | MALP-2-induced degradation of I | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Human | lung epithelial cells (small airway lung epithelial (SALE)) | NA | O60603.fasta | O60603 | 784 | This induces the inflammatory response. | NF-kappaB-luciferase reporter assays | 19265130 | 2009 | Pubchem Assay |
| PRRID_0375 | MALP-2 (macrophage-activating lipopeptide 2) Click for more detail | NA | C1=CC=C2C(=C1)C(=CN2)CC(C(=O)O)NC(=O)CCC(C(=O)O)N | NA | Lipopeptides | Natural | MALP-2-induced degradation of I | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Human | lung epithelial cells (small airway lung epithelial (SALE)) | NA | O60603.fasta | O60603 | 784 | This induces the inflammatory response. | NF-kappaB-luciferase reporter assays | 19265130 | 2009 | Pubchem Assay |
| PRRID_0377 | polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail | NA | C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O | NA | Nucleic Acid | Synthetic | Poly (I:C) induces the generation of IRF3-dependent type I IFN and triggers the activation of the Rho GTPase RhoA, which leads to the activation of NF-kappaB. | Toll-like receptor 3 (TLR3) | Toll-like receptor (TLR) | Human | lung epithelial cells (small airway lung epithelial (SALE)) | NA | O15455.fasta | O15455 | 904 | This induces the inflammatory response. | NF-kappaB-luciferase reporter assays | 19265130 | 2009 | Pubchem Assay |
| PRRID_0377 | polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail | NA | C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O | NA | Nucleic Acid | Synthetic | Poly (I:C) induces the generation of IRF3-dependent type I IFN and triggers the activation of the Rho GTPase RhoA, which leads to the activation of NF-kappaB. | Toll-like receptor 3 (TLR3) | Toll-like receptor (TLR) | Human | lung epithelial cells (small airway lung epithelial (SALE)) | NA | O15455.fasta | O15455 | 904 | This induces the inflammatory response. | NF-kappaB-luciferase reporter assays | 19265130 | 2009 | Pubchem Assay |