Browse result page of ImmunoSPdb

The total number entries retrieved from this search are 485
IDNameSequenceLengthChiralityN-Terminal ModificationC-Terminal ModificationChemical ModificationLinear/CyclicNatureSourceTargetMechanism of ActionIn vivo/ In vitroCell LineIC-50In vivo ModelAssay TypeLethal DoseCombination TherapyPubmed IDYear of Publication
1001Vm24AAAISCVGSPECPPKCRAQGCKNGKCMNRKCKCYYC36LNoneAmidationCross linked by eight cysteines (between Cys6 and Cys26, Cys12 and Cys31, Cys16 and Cys33, and Cys21 and Cys36) (Disulphide linkage)LinearNaturalVenom of the Mexican scorpion Vaejovis mexicanus smithiBlock Kv1.3 channels with high affinity, an estimated Kd of 2.9 pMInhibits T Cell Proliferation, CD25 Expression, and Ca2+ Signaling In Vitro and Suppresses DTH Reactions In VivoBothHuman peripheral T Cells, COS-7, human embryonic kidney 293, tsA201, L929, and MEL cellsNAFemale Lewis rats (9-10 weeks of age)T cell Proliferation assaysNANA226223632012
1002Cyclosporin A (CsA)cyclo[Abu-Sar-N(Me)Leu-Val-N(Me)Leu-Ala-D-Ala-N(Me)Leu-N(Me)Leu-N(Me)Val-N(Me)Bmt(E)]11MixNoneNoneBmt = butenyl-methyl-threonine, Abu = L-alpha-aminobutyric acid, Sar = sarcosine, N(Me) = Amino acid is N-methylatedCyclicNaturalFungusReduction of the IL-2 surface receptor CD25 expression (76%±11 after 24 hrs and 62%±7.3 after 36 hrs), also reduces TNF-α expression (23%±1.8)Inhibits the production of IL-2In vitroHuman peripheral Lymphocytes and purified T cellsNANoneCell Proliferation assay, Ca2+ release assay, Cytokines release assayNANA238408032013
1003Native kalata B1GLPVCGETCVGGTCNTPGCTCSWPVCTRN29LNoneNoneThree Disulfide linkage (CI-CIV, CII-CV and CIII-CVI)Cyclic (head to tailNatural cyclotideA cyclotide isolated from Oldenlandia affinis DC. (Rubiaceae)Reduction of the IL-2 surface receptor CD25 expression (79%±10 after 24 hrs and 46%±18 after 36 hrs), also reduces TNF-α expression (23%±11)Suppress T-cell polyfunctionality and arrest the proliferation of immune-competent cells through inhibiting IL-2 biology at more than one site as IL-2) surface receptor as well as IL-2 cytokine secretion and IL-2 gene expression.In vitroHuman peripheral Lymphocytes2.9±1.3 micromolar for Lymphocytes (PBMCs)NACell Proliferation assay, Ca2+ release assay, Cytokines release assayNANA238408032013
1004Native kalata B2GLPVCGETCVGGTCNTPGCTCSWPVCTRN29LNoneNoneThree Disulfide linkage (CI-CIV, CII-CV and CIII-CVI)Cyclic (head to tailNatural cyclotideA cyclotide isolated from Oldenlandia affinis DC. (Rubiaceae)Reduction of the IL-2 surface receptor CD25 expression (79%±10 after 24 hrs and 46%±18 after 36 hrs), also reduces TNF-α expression (23%±11)Suppress T-cell polyfunctionality and arrest the proliferation of immune-competent cells through inhibiting IL-2 biology at more than one site as IL-2) surface receptor as well as IL-2 cytokine secretion and IL-2 gene expression.In vitroPurified T cells2.4±0.5 micromolar for purified T cellsNACell Proliferation assay, Ca2+ release assay, Cytokines release assayNANA238408032013
1011OSK1 (α-KTx3.7)GVIINVKCKISRQCLEPCKKAGMRFGKCMNGKCHCTPK38LNoneNoneThree- Disulphide-bridge C1-C4, C2-C5 and C3-C6)LinearNaturalVenom of the central Asian scorpion Orthochirus scrobiculosusKv 1.1, Kv 1.2 and Kv 1.3 channel and also Ca2+ activated KCa 3.1 channelPotent blocker of three different Kv channel types and a moderate blocker of Ca2+ -activated KCa 3.1 channelBothL929 and MEL (murine erythroleukaemia), COS-7 cells, tsA cell line, LTK-cells (lacking leucocyte tyrosine kinase), CHL (Chinese-hamster lung) cells, HEK-293 (human embryonic kidney) cells0.60±0.04 nM for Kv1.1C57/BL6 miceNeurotoxicity of peptide, Pharmacological activity on various K+ (Potassium) channel2.5 (μg/kg of mice)NA155882512005
1012OSK1 (α-KTx3.7)GVIINVKCKISRQCLEPCKKAGMRFGKCMNGKCHCTPK38LNoneNoneThree- Disulphide-bridge (C1C4, C2-C5 and C3-C6)LinearNaturalVenom of the central Asian scorpion Orthochirus scrobiculosusKv 1.1, Kv 1.2 and Kv 1.3 channel and also Ca2+ -activated KCa 3.1 channelPotent blocker of three different Kv channel types and a moderate blocker of Ca2+ -activated KCa 3.1 channelBothL929 and MEL (murine erythroleukaemia), COS-7 cells, tsA cell line, LTK-cells (lacking leucocyte tyrosine kinase), CHL (Chinese-hamster lung) cells, HEK-293 (human embryonic kidney) cells5.40±1.89 nM for Kv1.2C57/BL6 miceNeurotoxicity of peptide, Pharmacological activity on various K+ (Potassium) channel2.5 (μg/kg of mice)NA155882512005
1013OSK1 (α-KTx3.7)GVIINVKCKISRQCLEPCKKAGMRFGKCMNGKCHCTPK38LNoneNoneThree- Disulphide-bridge (C-C4, C2-C5 and C3-C6)LinearNaturalVenom of the central Asian scorpion Orthochirus scrobiculosusKv 1.1, Kv 1.2 and Kv 1.3 channel and also Ca2+ -activated KCa 3.1 channelPotent blocker of three different Kv channel types and a moderate blocker of Ca2+ -activated KCa 3.1 channelBothL929 and MEL (murine erythroleukaemia), COS-7 cells, tsA cell line, LTK-cells (lacking leucocyte tyrosine kinase), CHL (Chinese-hamster lung) cells, HEK-293 (human embryonic kidney) cells0.014±0.001 nM for Kv1.3C57/BL6 miceNeurotoxicity of peptide, Pharmacological activity on various K+ (Potassium) channel2.5 (μg/kg of mice)NA155882512005
1014OSK1 (α-KTx3.7)GVIINVKCKISRQCLEPCKKAGMRFGKCMNGKCHCTPK38LNoneNoneThree- Disulphide-bridge C1-C4, C2-C5 and C3-C6)LinearNaturalVenom of the central Asian scorpion Orthochirus scrobiculosusKv 1.1, Kv 1.2 and Kv 1.3 channel and also Ca2+ -activated KCa 3.1 channelPotent blocker of three different Kv channel types and a moderate blocker of Ca2+ -activated KCa 3.1 channelBothL929 and MEL (murine erythroleukaemia), COS-7 cells, tsA cell line, LTK-cells (lacking leucocyte tyrosine kinase), CHL (Chinese-hamster lung) cells, HEK-293 (human embryonic kidney) cells225±10 nM for Kca 3.1C57/BL6 miceNeurotoxicity of peptide, Pharmacological activity on various K+ (Potassium) channel2.5 (μg/kg of mice)NA155882512005
1015[K16 ,D20 ]-OSK1GVIINVKCKISRQCLKPCKDAGMRFGKCMNGKCHCTPK38LNoneNoneThree- Disulphide-bridge (C1-C4, C2-C5 and C3-C6)LinearSyntheticNAKv 1.1, Kv 1.2 and Kv 1.3 channel and also Ca2+ -activated KCa 3.1 channelPotent blocker of three different Kv channel types and a moderate blocker of Ca2+ -activated KCa 3.1 channelBothL929 and MEL (murine erythroleukaemia), COS-7 cells, tsA cell line, LTK-cells (lacking leucocyte tyrosine kinase), CHL (Chinese-hamster lung) cells, HEK-293 (human embryonic kidney) cells0.40± 0.01 nM for Kv1.1C57/BL6 miceNeurotoxicity of peptide, Pharmacological activity on various K+ (Potassium) channel2.5 (μg/kg of mice)NA155882512005
1016[K16 ,D20 ]-OSK1GVIINVKCKISRQCLKPCKDAGMRFGKCMNGKCHCTPK38LNoneNoneThree- Disulphide-bridge (C1-C4, C2-C5 and C3-C6)LinearSyntheticNAKv 1.1, Kv 1.2 and Kv 1.3 channel and also Ca2+ -activated KCa 3.1 channelPotent blocker of three different Kv channel types and a moderate blocker of Ca2+ -activated KCa 3.1 channelBothL929 and MEL (murine erythroleukaemia), COS-7 cells, tsA cell line, LTK-cells (lacking leucocyte tyrosine kinase), CHL (Chinese-hamster lung) cells, HEK-293 (human embryonic kidney) cells2.96±0.01 nM for Kv1.2C57/BL6 miceNeurotoxicity of peptide, Pharmacological activity on various K+ (Potassium) channel2.5 (μg/kg of mice)NA155882512005
1017[K16 ,D20 ]-OSK1GVIINVKCKISRQCLKPCKDAGMRFGKCMNGKCHCTPK38LNoneNoneThree- Disulphide-bridge (C1-C4, C2-C5 and C3-C6)LinearSyntheticNAKv 1.1, Kv 1.2 and Kv 1.3 channel and also Ca2+ -activated KCa 3.1 channelPotent blocker of three different Kv channel types and a moderate blocker of Ca2+ -activated KCa 3.1 channelBothL929 and MEL (murine erythroleukaemia), COS-7 cells, tsA cell line, LTK-cells (lacking leucocyte tyrosine kinase), CHL (Chinese-hamster lung) cells, HEK-293 (human embryonic kidney) cells0.003± 0.0011 nM for Kv1.3C57/BL6 miceNeurotoxicity of peptide, Pharmacological activity on various K+ (Potassium) channel2.5 (μg/kg of mice)NA155882512005
1018[K16 ,D20 ]-OSK1GVIINVKCKISRQCLKPCKDAGMRFGKCMNGKCHCTPK38LNoneNoneThree- Disulphide-bridge (C1-C4, C2-C5 and C3-C6)LinearSyntheticNAKv 1.1, Kv 1.2 and Kv 1.3 channel and also Ca2+ -activated KCa 3.1 channelPotent blocker of three different Kv channel types and a moderate blocker of Ca2+ -activated KCa 3.1 channelBothL929 and MEL (murine erythroleukaemia), COS-7 cells, tsA cell line, LTK-cells (lacking leucocyte tyrosine kinase), CHL (Chinese-hamster lung) cells, HEK-293 (human embryonic kidney) cells228±92 nM for Kca 3.1C57/BL6 miceNeurotoxicity of peptide, Pharmacological activity on various K+ (Potassium) channel2.5 (μg/kg of mice)NA155882512005
1019[K16 ]-OSK1GVIINVKCKISRQCLKPCKKAGMRFGKCMNGKCHCTPK38LNoneNoneThree- Disulphide-bridge (C1-C4, C2-C5 and C3-C6)LinearSyntheticNAKv 1.1, Kv 1.2 and Kv 1.3 channel and also Ca2+ -activated KCa 3.1 channelPotent blocker of three different Kv channel types and a moderate blocker of Ca2+ -activated KCa 3.1 channelBothL929 and MEL (murine erythroleukaemia), COS-7 cells, tsA cell line, LTK-cells (lacking leucocyte tyrosine kinase), CHL (Chinese-hamster lung) cells, HEK-293 (human embryonic kidney) cells0.63±0.05 nM for Kv1.1C57/BL6 miceNeurotoxicity of peptide, Pharmacological activity on various K+ (Potassium) channel3 (μg/kg of mice)NA155882512005
1020[K16 ]-OSK1GVIINVKCKISRQCLKPCKKAGMRFGKCMNGKCHCTPK38LNoneNoneThree- Disulphide-bridge (C1-C4, C2-C5 and C3-C6)LinearSyntheticNAKv 1.1, Kv 1.2 and Kv 1.3 channel and also Ca2+ -activated KCa 3.1 channelPotent blocker of three different Kv channel types and a moderate blocker of Ca2+ -activated KCa 3.1 channelBothL929 and MEL (murine erythroleukaemia), COS-7 cells, tsA cell line, LTK-cells (lacking leucocyte tyrosine kinase), CHL (Chinese-hamster lung) cells, HEK-293 (human embryonic kidney) cells5.23±0.22 nM for Kv1.2C57/BL6 miceNeurotoxicity of peptide, Pharmacological activity on various K+ (Potassium) channel3 (μg/kg of mice)NA155882512005
1021[K16 ]-OSK1GVIINVKCKISRQCLKPCKKAGMRFGKCMNGKCHCTPK38LNoneNoneThree- Disulphide-bridge (C1-C4, C2-C5 and C3-C6)LinearSyntheticNAKv 1.1, Kv 1.2 and Kv 1.3 channel and also Ca2+ -activated KCa 3.1 channelPotent blocker of three different Kv channel types and a moderate blocker of Ca2+ -activated KCa 3.1 channelBothL929 and MEL (murine erythroleukaemia), COS-7 cells, tsA cell line, LTK-cells (lacking leucocyte tyrosine kinase), CHL (Chinese-hamster lung) cells, HEK-293 (human embryonic kidney) cells0.067±0.006 nM for Kv1.3C57/BL6 miceNeurotoxicity of peptide, Pharmacological activity on various K+ (Potassium) channel3 (μg/kg of mice)NA155882512005
1022[K16 ]-OSK1GVIINVKCKISRQCLKPCKKAGMRFGKCMNGKCHCTPK38LNoneNoneThree- Disulphide-bridge (C1-C4, C2-C5 and C3-C6)LinearSyntheticNAKv 1.1, Kv 1.2 and Kv 1.3 channel and also Ca2+ -activated KCa 3.1 channelPotent blocker of three different Kv channel types and a moderate blocker of Ca2+ -activated KCa 3.1 channelBothL929 and MEL (murine erythroleukaemia), COS-7 cells, tsA cell line, LTK-cells (lacking leucocyte tyrosine kinase), CHL (Chinese-hamster lung) cells, HEK-293 (human embryonic kidney) cells151±21 nM for Kca 3.1C57/BL6 miceNeurotoxicity of peptide, Pharmacological activity on various K+ (Potassium) channel3 (μg/kg of mice)NA155882512005
1023[D20 ]-OSK1GVIINVKCKISRQCLEPCKDAGMRFGKCMNGKCHCTPK38LNoneNoneThree- Disulphide-bridge (C1-C4, C2-C5 and C3-C6)LinearSyntheticNAKv 1.1, Kv 1.2 and Kv 1.3 channel and also Ca2+ -activated KCa 3.1 channelPotent blocker of three different Kv channel types and a moderate blocker of Ca2+ -activated KCa 3.1 channelBothL929 and MEL (murine erythroleukaemia), COS-7 cells, tsA cell line, LTK-cells (lacking leucocyte tyrosine kinase), CHL (Chinese-hamster lung) cells, HEK-293 (human embryonic kidney) cells2.95±0.24 nM for Kv1.1C57/BL6 miceNeurotoxicity of peptide, Pharmacological activity on various K+ (Potassium) channel4.5 (μg/kg of mice)NA155882512005
1024[D20 ]-OSK1GVIINVKCKISRQCLEPCKDAGMRFGKCMNGKCHCTPK38LNoneNoneThree- Disulphide-bridge (C1-C4, C2-C5 and C3-C6)LinearSyntheticNAKv 1.1, Kv 1.2 and Kv 1.3 channel and also Ca2+ -activated KCa 3.1 channelPotent blocker of three different Kv channel types and a moderate blocker of Ca2+ -activated KCa 3.1 channelBothL929 and MEL (murine erythroleukaemia), COS-7 cells, tsA cell line, LTK-cells (lacking leucocyte tyrosine kinase), CHL (Chinese-hamster lung) cells, HEK-293 (human embryonic kidney) cells77.8± 9.2 nM for Kv1.2C57/BL6 miceNeurotoxicity of peptide, Pharmacological activity on various K+ (Potassium) channel4.5 (μg/kg of mice)NA155882512005
1025[D20 ]-OSK1GVIINVKCKISRQCLEPCKDAGMRFGKCMNGKCHCTPK38LNoneNoneThree- Disulphide-bridge (C1-C4, C2-C5 and C3-C6)LinearSyntheticNAKv 1.1, Kv 1.2 and Kv 1.3 channel and also Ca2+ -activated KCa 3.1 channelPotent blocker of three different Kv channel types and a moderate blocker of Ca2+ -activated KCa 3.1 channelBothL929 and MEL (murine erythroleukaemia), COS-7 cells, tsA cell line, LTK-cells (lacking leucocyte tyrosine kinase), CHL (Chinese-hamster lung) cells, HEK-293 (human embryonic kidney) cells0.037±0.007 nM for Kv1.3C57/BL6 miceNeurotoxicity of peptide, Pharmacological activity on various K+ (Potassium) channel4.5 (μg/kg of mice)NA155882512005
1026[D20 ]-OSK1GVIINVKCKISRQCLEPCKDAGMRFGKCMNGKCHCTPK38LNoneNoneThree- Disulphide-bridge (C1-C4, C2-C5 and C3-C6)LinearSyntheticNAKv 1.1, Kv 1.2 and Kv 1.3 channel and also Ca2+ -activated KCa 3.1 channelPotent blocker of three different Kv channel types and a moderate blocker of Ca2+ -activated KCa 3.1 channelBothL929 and MEL (murine erythroleukaemia), COS-7 cells, tsA cell line, LTK-cells (lacking leucocyte tyrosine kinase), CHL (Chinese-hamster lung) cells, HEK-293 (human embryonic kidney) cells716±10 nM for Kca 3.1C57/BL6 miceNeurotoxicity of peptide, Pharmacological activity on various K+ (Potassium) channel4.5 (μg/kg of mice)NA155882512005
1027[P12 ,K16 , D20]-OSK1GVIINVKCKISPQCLKPCKDAGMRFGKCMNGKCHCTPK38LNoneNoneThree- Disulphide-bridge (C1-C4, C2-C5 and C3-C6)LinearSyntheticNAKv 1.1, Kv 1.2 and Kv 1.3 channel and also Ca2+ -activated KCa 3.1 channelPotent blocker of three different Kv channel types and a moderate blocker of Ca2+ -activated KCa 3.1 channelBothL929 and MEL (murine erythroleukaemia), COS-7 cells, tsA cell line, LTK-cells (lacking leucocyte tyrosine kinase), CHL (Chinese-hamster lung) cells, HEK-293 (human embryonic kidney) cells3.18± 0.11 nM for Kv1.1C57/BL6 miceNeurotoxicity of peptide, Pharmacological activity on various K+ (Potassium) channel7.5 (μg/kg of mice)NA155882512005
1028[P12 ,K16 , D20]-OSK1GVIINVKCKISPQCLKPCKDAGMRFGKCMNGKCHCTPK38LNoneNoneThree- Disulphide-bridge (C1-C4, C2-C5 and C3-C6)LinearSyntheticNAKv 1.1, Kv 1.2 and Kv 1.3 channel and also Ca2+ -activated KCa 3.1 channelPotent blocker of three different Kv channel types and a moderate blocker of Ca2+ -activated KCa 3.1 channelBothL929 and MEL (murine erythroleukaemia), COS-7 cells, tsA cell line, LTK-cells (lacking leucocyte tyrosine kinase), CHL (Chinese-hamster lung) cells, HEK-293 (human embryonic kidney) cells196±9 nM for Kv1.2C57/BL6 miceNeurotoxicity of peptide, Pharmacological activity on various K+ (Potassium) channel7.5 (μg/kg of mice)NA155882512005
1029[P12 ,K16 , D20]-OSK1GVIINVKCKISPQCLKPCKDAGMRFGKCMNGKCHCTPK38LNoneNoneThree- Disulphide-bridge (C1-C4, C2-C5 and C3-C6)LinearSyntheticNAKv 1.1, Kv 1.2 and Kv 1.3 channel and also Ca2+ -activated KCa 3.1 channelPotent blocker of three different Kv channel types and a moderate blocker of Ca2+ -activated KCa 3.1 channelBothL929 and MEL (murine erythroleukaemia), COS-7 cells, tsA cell line, LTK-cells (lacking leucocyte tyrosine kinase), CHL (Chinese-hamster lung) cells, HEK-293 (human embryonic kidney) cells0.059±0.003 nM for Kv1.3C57/BL6 miceNeurotoxicity of peptide, Pharmacological activity on various K+ (Potassium) channel7.5 (μg/kg of mice)NA155882512005
1030[P12 ,K16 , D20]-OSK1GVIINVKCKISPQCLKPCKDAGMRFGKCMNGKCHCTPK38LNoneNoneThree- Disulphide-bridge (C1-C4, C2-C5 and C3-C6)LinearSyntheticNAKv 1.1, Kv 1.2 and Kv 1.3 channel and also Ca2+ -activated KCa 3.1 channelPotent blocker of three different Kv channel types and a moderate blocker of Ca2+ -activated KCa 3.1 channelBothL929 and MEL (murine erythroleukaemia), COS-7 cells, tsA cell line, LTK-cells (lacking leucocyte tyrosine kinase), CHL (Chinese-hamster lung) cells, HEK-293 (human embryonic kidney) cells2600±400 nM for Kca 3.1C57/BL6 miceNeurotoxicity of peptide, Pharmacological activity on various K+ (Potassium) channel7.5 (μg/kg of mice)NA155882512005
1031[K16,D20,Y36]-OSK1GVIINVKCKISRQCLKPCKDAGMRFGKCMNGKCHCYPK38LNoneNoneThree- Disulphide-bridge (C1-C4, C2-C5 and C3-C6)LinearSyntheticNAKv 1.1, Kv 1.2, Kv 1.3 and Kv 1.7 channel and also Ca2+ -activated KCa 3.1 channelBlocker of four different Kv channel types and also blocker of Ca2+ -activated KCa 3.1 channelBothL929 and MEL (murine erythroleukaemia), COS-7 cells, tsA cell line, LTK-cells (lacking leucocyte tyrosine kinase), CHL (Chinese-hamster lung) cells, HEK-293 (human embryonic kidney) cells34.4±0.3 nM for Kv1.1C57/BL6 miceNeurotoxicity of peptide, Pharmacological activity on various K+ (Potassium) channel9 (μg/kg of mice)NA155882512005
1032[K16,D20,Y36]-OSK1GVIINVKCKISRQCLKPCKDAGMRFGKCMNGKCHCYPK38LNoneNoneThree- Disulphide-bridge (C1-C4, C2-C5 and C3-C6)LinearSyntheticNAKv 1.1, Kv 1.2, Kv 1.3 and Kv 1.7 channel and also Ca2+ -activated KCa 3.1 channelBlocker of four different Kv channel types and also blocker of Ca2+ -activated KCa 3.1 channelBothL929 and MEL (murine erythroleukaemia), COS-7 cells, tsA cell line, LTK-cells (lacking leucocyte tyrosine kinase), CHL (Chinese-hamster lung) cells, HEK-293 (human embryonic kidney) cells232±11 nM for Kv1.2C57/BL6 miceNeurotoxicity of peptide, Pharmacological activity on various K+ (Potassium) channel9 (μg/kg of mice)NA155882512005
1033[K16,D20,Y36]-OSK1GVIINVKCKISRQCLKPCKDAGMRFGKCMNGKCHCYPK38LNoneNoneThree- Disulphide-bridge (C1-C4, C2-C5 and C3-C6)LinearSyntheticNAKv 1.1, Kv 1.2, Kv 1.3 and Kv 1.7 channel and also Ca2+ -activated KCa 3.1 channelBlocker of four different Kv channel types and also blocker of Ca2+ -activated KCa 3.1 channelBothL929 and MEL (murine erythroleukaemia), COS-7 cells, tsA cell line, LTK-cells (lacking leucocyte tyrosine kinase), CHL (Chinese-hamster lung) cells, HEK-293 (human embryonic kidney) cells0.122± 0.007 nM for Kv1.3C57/BL6 miceNeurotoxicity of peptide, Pharmacological activity on various K+ (Potassium) channel9 (μg/kg of mice)NA155882512005
1034[K16,D20,Y36]-OSK1GVIINVKCKISRQCLKPCKDAGMRFGKCMNGKCHCYPK38LNoneNoneThree- Disulphide-bridge (C1-C4, C2-C5 and C3-C6)LinearSyntheticNAKv 1.1, Kv 1.2, Kv 1.3 and Kv 1.7 channel and also Ca2+ -activated KCa 3.1 channelBlocker of four different Kv channel types and also blocker of Ca2+ -activated KCa 3.1 channelBothL929 and MEL (murine erythroleukaemia), COS-7 cells, tsA cell line, LTK-cells (lacking leucocyte tyrosine kinase), CHL (Chinese-hamster lung) cells, HEK-293 (human embryonic kidney) cells1500±500 nM for Kv1.7C57/BL6 miceNeurotoxicity of peptide, Pharmacological activity on various K+ (Potassium) channel9 (μg/kg of mice)NA155882512005
1035[K16,D20,Y36]-OSK1GVIINVKCKISRQCLKPCKDAGMRFGKCMNGKCHCYPK38LNoneNoneThree- Disulphide-bridge (C1-C4, C2-C5 and C3-C6)LinearSyntheticNAKv 1.1, Kv 1.2, Kv 1.3 and Kv 1.7 channel and also Ca2+ -activated KCa 3.1 channelBlocker of four different Kv channel types and also blocker of Ca2+ -activated KCa 3.1 channelBothL929 and MEL (murine erythroleukaemia), COS-7 cells, tsA cell line, LTK-cells (lacking leucocyte tyrosine kinase), CHL (Chinese-hamster lung) cells, HEK-293 (human embryonic kidney) cells885±18 nM for Kca 3.1C57/BL6 miceNeurotoxicity of peptide, Pharmacological activity on various K+ (Potassium) channel9 (μg/kg of mice)NA155882512005
1036Cyclosporin Acyclo[Abu-Sar-N(Me)Leu-Val-N(Me)Leu-Ala-D-Ala-N(Me)Leu-N(Me)Leu-N(Me)Val-N(Me)Bmt(E)]11MixNoneNoneBmt = butenyl-methyl-threonine, Abu = L-alpha-aminobutyric acid, Sar = sarcosine, N(Me) = Amino acid is N-methylatedCyclicNaturalFrom fungus Trichoderma polysporumInhibit IL-2 production by activated CD4+ T-cellsInhibiting the calcineurin pathwayBothPeripheral blood mononuclear cells (PBMCs)61.8 nM for CD4+ T cell activation of IL-2 productionC57/B6 miceMIC assay, Immunosuppression and toxicity testNANA185998252008
1037Colutellin AVISIIPV7LNoneNoneNoneCyclicNaturalEndophytic fungus Colletotrichum dematiumInhibit IL-2 production by activated CD4+ T-cellsInhibiting the calcineurin pathwayBothPeripheral blood mononuclear cells (PBMCs)167.3±0.38 nM for CD4+ T cell activation of IL-2 productionC57/B6 miceMIC assay, Immunosuppression and toxicity testMIC of 3.6 mg/ml (48 h) against Botrytis cinerea and Sclerotinia sclerotiorum.NA185998252008
1042ISP region (Mutant D105)EVVLQNRRGLDLLTAEQGGICLALQEKCCFYANKS35LNoneNoneNoneLinearProtein DerivedWithin the transmembrane (TM) protein of Mason-Pfizer monkey virusT-cell and B-cellImmunosuppressive effect on both T-cell and B-cell mitogenic responseIn vitroHeLa, COS-1, CV-1and BHK cellsNANANANANA13164621992
1043ISP region (Mutant D33)LQNRRGLDLLT11LNoneNoneNoneLinearProtein DerivedWithin the transmembrane (TM) protein of Mason-Pfizer monkey virusT-cell and B-cellImmunosuppressive effect on both T-cell and B-cell mitogenic responseIn vitroHeLa, COS-1, CV-1and BHK cellsNANANANANA13164621992
1044Cyclosporin Acyclo[Abu-Sar-N(Me)Leu-Val-N(Me)Leu-Ala-D-Ala-N(Me)Leu-N(Me)Leu-N(Me)Val-N(Me)Bmt(E)]11MixNoneNoneBmt = butenyl-methyl-threonine, Abu = L-alpha-aminobutyric acid, Sar = sarcosine, N(Me) = Amino acid is N-methylatedCyclicNaturalFrom fungus Trichoderma polysporumCa2+-dependent permeability transitionInhibit the Ca2+ dependent permeability transitionIn vivoNANAMale Sprague-Dawley ratNANANA24707341989
1045Cyclolinopeptide A (CLA)VPPFFLIIL9LNoneNoneNoneCyclicNaturalisolated from linseed oilCyclophilin A, IL-1α, IL-2it binds to cyclophilin A and inhibits the action of Interleukin-1-alpha and Interleukin-2BothSRBC (Sheep red blood cells)dose combinations: 0.1 mg/ml of CLA and 0.25 mM of MTX exhibited suppressive, synergistic action12-week-old BALB/c female miceSecondary humoral immune responseNAMethotrexate (MTX) 218395482011
1046CLA analogue1LVPPFFLII9LNoneNoneEthylene bridge (-CH2-CH2-) between phenylalanine nitrogensCyclicSyntheticAnalog of cyclolinopeptide A (CLA)NANABothSRBC (Sheep red blood cells)NA12-week-old BALB/c female miceSecondary humoral immune responseNANA218395482011
1047CLA analogue2LVPPffLII9MixNoneNoneEthylene bridge (-CH2-CH2-) between phenylalanine nitrogensCyclicSyntheticAnalog of cyclolinopeptide A (CLA)NANABothSRBC (Sheep red blood cells)NA12-week-old BALB/c female miceSecondary humoral immune responseNANA218395482011
1048CLA analogue3LVPPFFLII9LNoneNoneEthylene bridge (-CH2-CH2-) between phenylalanine nitrogensLinearSyntheticAnalog of cyclolinopeptide A (CLA)NANABothSRBC (Sheep red blood cells)NA12-week-old BALB/c female miceSecondary humoral immune responseNANA218395482011
1049CLA analogue4LVPPffLII9MixNoneNoneEthylene bridge (-CH2-CH2-) between phenylalanine nitrogensLinearSyntheticAnalog of cyclolinopeptide A (CLA)NANABothSRBC (Sheep red blood cells)NA12-week-old BALB/c female miceSecondary humoral immune responseNANA218395482011
1050CLA analogue5LVPPFFLII9LNoneNoneNoneLinearSyntheticAnalog of cyclolinopeptide A (CLA)NANABothSRBC (Sheep red blood cells)NA12-week-old BALB/c female miceSecondary humoral immune responseNANA218395482011
1051Vm24AAAISCVGSPECPPKCRAQGCKNGKCMNRKCKCYYC36LNoneAmidationFour Disulfide bridges (between Cys6 and Cys26, Cys12 and Cys31, Cys16 and Cys33, and Cys21 and Cys36)LinearNaturalvenom of the Mexican scorpion Vaejovis mexicanus smithiK+ channelRemarkable blocking potency and selectivity for Kv1.3 channelsBothMononuclear cells from human peripheral venous blood90% inhibition achieved at 100pMMouse modelLethality testNo toxicity for 50 to 200 μg of protein per mouse (20 g body weight)NA225401872012
1052MargatoxinTIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH39LNoneNoneNoneLinearNaturalPurified from venom of the scorpion Centruroides margaritatusKv1.3 channelInhibit both Th1 and Th2 cytokine productionNANANANANANANA127479502003
1053MargatoxinTIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH39LNoneNoneNoneLinearSyntheticRecombinantnt was made by expressing the synthetic cDNA in Escherichia coliKv1.3 channelInhibit both Th1 and Th2 cytokine productionBothHuman peripheral blood mononuclear cells (PBMC), Purified T cells, Human monocytes, Human monocytic cell line, THP-10.013 nM for IL-2 when stimulation with PMA and ionomycinMini swine modelProliferation asaay, detection of intracellular cytokines, Antibody-dependent cellular cytotoxicity assayNANA127479502003
1054MargatoxinTIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH39LNoneNoneNoneLinearSyntheticRecombinantnt was made by expressing the synthetic cDNA in Escherichia coliKv1.3 channelInhibit both Th1 and Th2 cytokine productionBothHuman peripheral blood mononuclear cells (PBMC), Purified T cells, Human monocytes, Human monocytic cell line, THP-20.016 nM for IL-4 when stimulation with PMA and ionomycinMini swine modelProliferation asaay, detection of intracellular cytokines, Antibody-dependent cellular cytotoxicity assayNANA127479502003
1055MargatoxinTIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH39LNoneNoneNoneLinearSyntheticRecombinantnt was made by expressing the synthetic cDNA in Escherichia coliKv1.3 channelInhibit both Th1 and Th2 cytokine productionBothHuman peripheral blood mononuclear cells (PBMC), Purified T cells, Human monocytes, Human monocytic cell line, THP-30.5 nM for IL-2 production when stimulated with a-CD3 and VCAM-1Mini swine modelProliferation asaay, detection of intracellular cytokines, Antibody-dependent cellular cytotoxicity assayNANA127479502003
1056MargatoxinTIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH39LNoneNoneNoneLinearSyntheticRecombinantnt was made by expressing the synthetic cDNA in Escherichia coliKv1.3 channelInhibit both Th1 and Th2 cytokine productionBothHuman peripheral blood mononuclear cells (PBMC), Purified T cells, Human monocytes, Human monocytic cell line, THP-40.13 nM for IL-4 production when stimulated with a-CD3 and VCAM-1Mini swine modelProliferation asaay, detection of intracellular cytokines, Antibody-dependent cellular cytotoxicity assayNANA127479502003
1057MargatoxinTIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH39LNoneNoneNoneLinearSyntheticRecombinantnt was made by expressing the synthetic cDNA in Escherichia coliKv1.3 channelInhibit both Th1 and Th2 cytokine productionBothHuman peripheral blood mononuclear cells (PBMC), Purified T cells, Human monocytes, Human monocytic cell line, THP-54.9 nM for a-CD3/VCAM-1 induced proliferationMini swine modelProliferation asaay, detection of intracellular cytokines, Antibody-dependent cellular cytotoxicity assayNANA127479502003
1058MargatoxinTIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH39LNoneNoneNoneLinearSyntheticRecombinantnt was made by expressing the synthetic cDNA in Escherichia coliKv1.3 channelInhibit both Th1 and Th2 cytokine productionBothHuman peripheral blood mononuclear cells (PBMC), Purified T cells, Human monocytes, Human monocytic cell line, THP-60.5 nM anti-CD3 mediated redirected cytolysis of CD8(+) T cellsMini swine modelProliferation asaay, detection of intracellular cytokines, Antibody-dependent cellular cytotoxicity assayNANA127479502003
1059MargatoxinTIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH39LNoneNoneNoneLinearSyntheticRecombinantnt was made by expressing the synthetic cDNA in Escherichia coliKv1.3 channelInhibit both Th1 and Th2 cytokine productionBothHuman peripheral blood mononuclear cells (PBMC), Purified T cells, Human monocytes, Human monocytic cell line, THP-70.5 nM anti-CD3 mediated redirected cytolysis of T cellsMini swine modelProliferation asaay, detection of intracellular cytokines, Antibody-dependent cellular cytotoxicity assayNANA127479502003
1060MargatoxinTIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH39LNoneNoneNoneLinearNaturalFrom venom of the new world scorpion Centruroides margaritatusKv1.3 channelsBlocks with high affinity and specificity the Kv1.3 channelIn vitroHuman peripheral T-Lymphocytes, rat brain synaptic plasma membrane vesicles, bovine aortic sarcolemmal membrane vesicle36 pMNAcompetition binding with Kv1.3 (Potassium channel)NANA83601761993