Browse result page of ImmunoSPdb

The total number entries retrieved from this search are 485

ID	Name	Sequence	Length	Chirality	N-Terminal Modification	C-Terminal Modification	Chemical Modification	Linear/Cyclic	Nature	Source	Target	Mechanism of Action	In vivo/ In vitro	Cell Line	IC-50	In vivo Model	Assay Type	Lethal Dose	Combination Therapy	Pubmed ID	Year of Publication
1367	CB11P	PTGPLGPKGQTGELGIAGFKGEQGPK	26	L	None	None	None	Linear	Protein Derived	Collagen derived	Bystander antigens	By releasing transforming growth factor β (TGF-β)	In vivo	None	NA	Rats	NA	NA	NA	US 5783188	1998
1368	CDP2	GE(HP)GA(HP)GPAGP(HP)GE(HP)GA(HP)GPAGP(HP)G	25	L	None	None	HP = Hydroxyproline	Linear	Protein Derived	Collagen derived	Bystander antigens	By releasing transforming growth factor β (TGF-β)	In vivo	None	NA	Rats	NA	NA	NA	US 5843445	1998
1369	CDP3	GEEGLRGARGE(HP)GERGP(HP)GPQGAR	24	L	None	None	HP = Hydroxyproline	Linear	Protein Derived	Collagen derived	Bystander antigens	By releasing transforming growth factor β (TGF-β)	In vivo	None	NA	Rats	NA	NA	NA	US 5843445	1998
1370	CB11P	PTGPLGPKGQTGELGIAGFKGEQGPK	26	L	None	None	None	Linear	Protein Derived	Collagen derived	Bystander antigens	By releasing transforming growth factor β (TGF-β)	In vivo	None	NA	Rats	NA	NA	NA	US 5843445	1998
1371	A2.94-112	TLQRMYGCDVGSDWRFLRG	19	L	None	None	None	Linear	Protein Derived	α2 domain of HLA-A2	B-Lymphoblastoid cells (B-cell)	Inhibit by binding to variable T cell receptor	In vitro	AJY CTL cell line	NA	None	Hummoral Immune Response assay	NA	NA	US 5888512	1999
1372	A2.98-113	MYGCDVGSDWRFLRGY	16	L	None	None	None	Linear	Protein Derived	α2 domain of HLA-A2	B-Lymphoblastoid cells (B-cell)	Inhibit by binding to variable T cell receptor	In vitro	AJY CTL cell line	NA	None	Hummoral Immune Response assay	NA	NA	US 5888512	1999
1373	A2.101-108	CDVGSDWR	8	L	None	None	None	Linear	Protein Derived	α2 domain of HLA-A2	B-Lymphoblastoid cells (B-cell)	Inhibit by binding to variable T cell receptor	In vitro	JY cells (HKA-A2, B7, DR4,6)	NA	None	Hummoral Immune Response assay	NA	NA	US 5888512	1999
1374	Nef2-19	GGKWSKSSVIGWPAVRERMRR	21	L	None	None	None	Linear	Natural	NL4.3 strain of HIV-1	T -cells	Downregulates CD4 and IL-2	In vitro	MT-2 cells	NA	None	Electroporation technique	NA	GST	US 5962635	1999
1375	SEQ ID2	SCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC	34	L	None	None	N-acetylation at position 18	Linear	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000
1376	SEQ ID3	CIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC	33	L	None	None	None	Linear	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000
1377	SEQ ID4	RSCIDTIPKSECTAFQCKHSMKYRLSFCRKTCGTC	35	L	None	None	N-acetylation at position 19	Linear	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000
1378	SEQ ID5	RSCIDTIPKSRCTAFECKHSMKYRLSFCRKTCGTC	35	L	None	None	None	Linear	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000
1379	SEQ ID6	RSCIDTIPKSRCTAFQCKKSMKYRLSFCRKTCGTC	35	L	None	None	None	Linear	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000
1380	SEQ ID7	RSCIDTIPKSRCTAFQCKHSMEYRLSFCRKTCGTC	35	L	None	None	None	Linear	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000
1381	SEQ ID8	RSCIDTIPKSRCTAFQCKHSMKXYRLSFCRKTCGTC	36	L	None	None	X = cyclohexylalanine	Linear	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000
1382	SEQ ID9	RSCIDTIPKSRCTAFQCKHSMAYRLSXCRKTCGTC	35	L	None	None	X = cyclohexylalanine	Linear	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000
1383	SEQ ID10	RSCATIPKSRCTAAQCKHSMKYRLSFCRKRCGTC	34	L	None	None	None	Linear	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000
1384	SEQ ID11	RSCIDSTIPKSRCTAAQKHSMKYRASFCRKTCGTC	35	L	None	None	None	Linear	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000
1385	SEQ ID12	RSCADTIPKSRCTAAQCKHSMKYRASFCRKTCGTC	35	L	None	None	None	Linear	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000
1386	SEQ ID13	SSCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC	35	L	None	None	None	Linear	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000
1387	SEQ ID14	RSCIDTIPQSRCTAFQCKHSMKYRLSFCRKTCGTC	35	L	None	None	None	Linear	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000
1388	SEQ ID15	RSCIDTIPKSQCTAFQCKHSMKYRLSFCRKTCGTC	35	L	None	None	None	Linear	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000
1389	SEQ ID16	RSCIDTIPKSRCTAAQCKHSMKYRLSFCRKTCGTC	35	L	None	None	None	Linear	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000
1390	SEQ ID17	RSCIDTIPKSQCTAWQCKHSMKYRLSFCRKTCGTC	35	L	None	None	None	Linear	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000
1391	SEQ ID18	RSCIDTIPKSQCTAFQCAHSMKYRLSFCRKTCGTC	35	L	None	None	None	Linear	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000
1392	SEQ ID19	RSCIDTIPKSQCTAFQCKHSXKYRLSFCRKTCGTC	35	L	None	None	X = norleucine (nL)	Linear	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000
1393	SEQ ID20	RSCIDTIPKSRCTAFQCKHSMAYRLSFCRKTCGTC	35	L	None	None	None	Linear	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000
1394	SEQ ID21	RSCIDTIPKSRCTAFQCKHSMXYRLSFCRKTCGTC	35	L	None	None	X = norleucine (nL)	Linear	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000
1395	SEQ ID22	RSCIDTIPKSRCTAFQCKHSMXYRLSFCRKTCGTC	35	L	None	None	X = ornithine	Linear	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000
1396	SEQ ID23	RSCIDTIPKSRCTAFQCKHSMXYRLSFCRKTCGTC	35	L	None	None	X = homocitrulline	Linear	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000
1397	SEQ ID24	RSCIDTIPKSRCTAFQCRHSMRYRLSFCRKTCGTC	35	L	None	None	None	Linear	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000
1398	SEQ ID25	RSCIDTIPKSRCTAFQCKHSMKFRLSFCRKTCGTC	35	L	None	None	None	Linear	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000
1399	SEQ ID26	RSCIDTIPKSRCTAFQCKHSMKXRLSFCRKTCGTC	35	L	None	None	X = nitrophenylalanine	Linear	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000
1400	SEQ ID27	RSCIDTIPKSRCTAFQCKHSMKXRLSFCRKTCGTC	35	L	None	None	X = aminophenylalanine	Linear	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000
1401	SEQ ID28	RSCIDTIPKSRCTAFQCKHSMKYALSFCRKTCGTC	35	L	None	None	None	Linear	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000
1402	SEQ ID29	ASCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC	35	L	None	None	None	Linear	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000
1403	SEQ ID30	RACIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC	35	L	None	None	None	Linear	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000
1404	SEQ ID31	RSCADTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC	35	L	None	None	None	Linear	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000
1405	SEQ ID32	RSCIATIPKSRCTAFQCKHSMKYRLSFCRKTCGTC	35	L	None	None	None	Linear	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000
1406	SEQ ID33	RSCIDAIPKSRCTAFQCKHSMKYRLSFCRKTCGTC	35	L	None	None	None	Linear	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000
1407	SEQ ID34	RSCIDTAPKSRCTAFQCKHSMKYRLSFCRKTCGTC	35	L	None	None	None	Linear	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000
1408	SEQ ID35	RSCIDTIAKSRCTAFQCKHSMKYRLSFCRKTCGTC	35	L	None	None	None	Linear	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000
1409	SEQ ID36	RSCIDTIPASRCTAFQCKHSMKYRLSFCRKTCGTC	35	L	None	None	None	Linear	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000
1410	SEQ ID37	RSCIDTIPKARCTAFQCKHSMKYRLSFCRKTCGTC	35	L	None	None	None	Linear	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000
1411	SEQ ID38	RSCIDTIPKSACTAFQCKHSMKYRLSFCRKTCGTC	35	L	None	None	None	Linear	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000
1412	SEQ ID39	RSCIDTIPKSRCAAFQCKHSMKYRLSFCRKTCGTC	35	L	None	None	None	Linear	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000
1413	SEQ ID40	RSCIDTIPKSRCTAAQCKHSMKYRLSFCRKTCGTC	35	L	None	None	None	Linear	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000
1414	SEQ ID41	RSCIDTIPKSRCTAFACKHSMKYRLSFCRKTCGTC	35	L	None	None	None	Linear	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000
1415	SEQ ID42	RSCIDTIPKSRCTAFQCAHSMKYRLSFCRKTCGTC	35	L	None	None	None	Linear	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000
1416	SEQ ID43	RSCIDTIPKSRCTAFQCKASMKYRLSFCRKTCGTC	35	L	None	None	None	Linear	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000