Primary information |
---|
ID | 1397 |
Peptide Name | SEQ ID24 |
Sequence | RSCIDTIPKSRCTAFQCRHSMRYRLSFCRKTCGTC |
Length | 35 |
Chirality | L |
N-terminal Modification | None |
C-terminal Modification | None |
Chemical Modification | None |
Linear/ Cyclic | Linear |
Nature | Natural |
Source of Origin | Shk toxin of S.helianthus |
Target | T Lymphocytes Kv1.3 channels |
Mechanism of Action | By blocking the potassium channel, Kv1.3 of T lymphocytes |
In vitro/In vivo | Both |
Cell Line | Peripheral blood human lymhocytes |
Inhibition Concentartion | 1 nM |
In vivo Model | CD18-nullPL/J mice |
Assay | Enzyme-linked immunosorbent assay (ELISA), HPLC |
Lethal Dose | NA |
Combination Therapy | Charybdotoxin (ChTX) |
Pubmed ID | US 6077680 |
Year of Publication | 2000 |
3-D Structure | View in Jmol or Download Structure |