| 1267 | SEQ ID NO:57 | DFQGSFCGQDLRFPLT | 16 | L | None | None | None | Linear | Protein Derived | Human Cartilage glycoprotein 39 | T-cells | Induce systemic immunological tolerance to the autoantigens under attack of the autoreactive T-cells, specific effect on the autoreactive T cells thus leaving the other components of the immune system intact | In vitro | PBMC | NA | NA | Peptide HLA-DR binding assay and Proliferative responses of blood mononuclear cells by thymidine incorporation assay | NA | NA | WO 1997040068 A1 | 1997 |
| 1268 | NA | CVCVCLLPRYPSAGVFTYLNTKIITFDSVLSCA | 33 | L | None | None | None | Linear | Protein Derived | Amino acid sequences derived from a human native nucleotide sequence capable of expressing GIF (glycosylation-inhibiting factors) | B-cells | Glycosylation inhibiting factor activity causing the suppression of immunoglobulin E (IgE) production | In vitro | Mesenteric lymph node (MLN) cells | NA | Lewis Rat | Rosette inhibition assay, tests of the IgE-SF activity | NA | NA | EP 0255394 A2 | 1987 |
| 1269 | Copolymer 1(Cop 1) | EKAY | 4 | L | None | None | None | Linear | Synthetic | NA (Random copolymer) | T-cells | Inhibits T cell proliferation in response to graft cells, preventing the secretion of cytokines like interleukin 2 (IL-2) and interferon γ (IFN-γ) | In vivo | NA | NA | BALB/c mice, Lewis rats | Skin Grafts Transplantation, Thyroid graft Transplantation | NA | Copolymer 1-related heteropolymers in combination with other immunosuppressive drugs induce a synergistic effect, This is used as copolymer or related hateropolymer | US 20060276390 A1 | 2006 |
| 1270 | Copolymer 1(Cop 1) | ekay | 4 | D | None | None | None | Linear | Synthetic | NA (Random copolymer) | T-cells | Inhibits T cell proliferation in response to graft cells, preventing the secretion of cytokines like interleukin 2 (IL-2) and interferon γ (IFN-γ) | In vivo | NA | NA | BALB/c mice, Lewis rats | Skin Grafts Transplantation, Thyroid graft Transplantation | NA | Copolymer 1-related heteropolymers in combination with other immunosuppressive drugs induce a synergistic effect, This is used as copolymer or related hateropolymer | US 20060276390 A1 | 2006 |
| 1271 | Copolymer 1(Cop 1) | EKAY | 4 | Mix | None | None | None | Linear | Synthetic | NA (Random copolymer) | T-cells | Inhibits T cell proliferation in response to graft cells, preventing the secretion of cytokines like interleukin 2 (IL-2) and interferon γ (IFN-γ) | In vivo | NA | NA | BALB/c mice, Lewis rats | Skin Grafts Transplantation, Thyroid graft Transplantation | NA | Copolymer 1-related heteropolymers in combination with other immunosuppressive drugs induce a synergistic effect, This is used as copolymer or related hateropolymer | US 20060276390 A1 | 2006 |
| 1272 | Copolymer 1-related heteropolymer | AAAYAAAAAAKAAAA | 15 | L | None | None | None | Linear | Synthetic | NA (Random copolymer) | T-cells | Inhibits T cell proliferation in response to graft cells, preventing the secretion of cytokines like interleukin 2 (IL-2) and interferon γ (IFN-γ) | In vivo | NA | NA | BALB/c mice, Lewis rats | Skin Grafts Transplantation, Thyroid graft Transplantation | NA | Copolymer 1-related heteropolymers in combination with other immunosuppressive drugs induce a synergistic effect, This is used as copolymer or related hateropolymer | US 20060276390 A1 | 2006 |
| 1273 | Copolymer 1-related heteropolymer | AEKYAAAAAAKAAAA | 15 | L | None | None | None | Linear | Synthetic | NA (Random copolymer) | T-cells | Inhibits T cell proliferation in response to graft cells, preventing the secretion of cytokines like interleukin 2 (IL-2) and interferon γ (IFN-γ) | In vivo | NA | NA | BALB/c mice, Lewis rats | Skin Grafts Transplantation, Thyroid graft Transplantation | NA | Copolymer 1-related heteropolymers in combination with other immunosuppressive drugs induce a synergistic effect, This is used as copolymer or related hateropolymer | US 20060276390 A1 | 2006 |
| 1274 | Copolymer 1-related heteropolymer | AKEYAAAAAAKAAAA | 15 | L | None | None | None | Linear | Synthetic | NA (Random copolymer) | T-cells | Inhibits T cell proliferation in response to graft cells, preventing the secretion of cytokines like interleukin 2 (IL-2) and interferon γ (IFN-γ) | In vivo | NA | NA | BALB/c mice, Lewis rats | Skin Grafts Transplantation, Thyroid graft Transplantation | NA | Copolymer 1-related heteropolymers in combination with other immunosuppressive drugs induce a synergistic effect, This is used as copolymer or related hateropolymer | US 20060276390 A1 | 2006 |
| 1275 | Copolymer 1-related heteropolymer | AKKYAAAAAAKAAAA | 15 | L | None | None | None | Linear | Synthetic | NA (Random copolymer) | T-cells | Inhibits T cell proliferation in response to graft cells, preventing the secretion of cytokines like interleukin 2 (IL-2) and interferon γ (IFN-γ) | In vivo | NA | NA | BALB/c mice, Lewis rats | Skin Grafts Transplantation, Thyroid graft Transplantation | NA | Copolymer 1-related heteropolymers in combination with other immunosuppressive drugs induce a synergistic effect, This is used as copolymer or related hateropolymer | US 20060276390 A1 | 2006 |
| 1276 | Copolymer 1-related heteropolymer | AEAYAAAAAAKAAAA | 15 | L | None | None | None | Linear | Synthetic | NA (Random copolymer) | T-cells | Inhibits T cell proliferation in response to graft cells, preventing the secretion of cytokines like interleukin 2 (IL-2) and interferon γ (IFN-γ) | In vivo | NA | NA | BALB/c mice, Lewis rats | Skin Grafts Transplantation, Thyroid graft Transplantation | NA | Copolymer 1-related heteropolymers in combination with other immunosuppressive drugs induce a synergistic effect, This is used as copolymer or related hateropolymer | US 20060276390 A1 | 2006 |
| 1277 | Copolymer 1-related heteropolymer | KEAYAAAAAAKAAAA | 15 | L | None | None | None | Linear | Synthetic | NA (Random copolymer) | T-cells | Inhibits T cell proliferation in response to graft cells, preventing the secretion of cytokines like interleukin 2 (IL-2) and interferon γ (IFN-γ) | In vivo | NA | NA | BALB/c mice, Lewis rats | Skin Grafts Transplantation, Thyroid graft Transplantation | NA | Copolymer 1-related heteropolymers in combination with other immunosuppressive drugs induce a synergistic effect, This is used as copolymer or related hateropolymer | US 20060276390 A1 | 2006 |
| 1278 | Copolymer 1-related heteropolymer | AEEYAAAAAAKAAAA | 15 | L | None | None | None | Linear | Synthetic | NA (Random copolymer) | T-cells | Inhibits T cell proliferation in response to graft cells, preventing the secretion of cytokines like interleukin 2 (IL-2) and interferon γ (IFN-γ) | In vivo | NA | NA | BALB/c mice, Lewis rats | Skin Grafts Transplantation, Thyroid graft Transplantation | NA | Copolymer 1-related heteropolymers in combination with other immunosuppressive drugs induce a synergistic effect, This is used as copolymer or related hateropolymer | US 20060276390 A1 | 2006 |
| 1279 | Copolymer 1-related heteropolymer | AAEYAAAAAAKAAAA | 15 | L | None | None | None | Linear | Synthetic | NA (Random copolymer) | T-cells | Inhibits T cell proliferation in response to graft cells, preventing the secretion of cytokines like interleukin 2 (IL-2) and interferon γ (IFN-γ) | In vivo | NA | NA | BALB/c mice, Lewis rats | Skin Grafts Transplantation, Thyroid graft Transplantation | NA | Copolymer 1-related heteropolymers in combination with other immunosuppressive drugs induce a synergistic effect, This is used as copolymer or related hateropolymer | US 20060276390 A1 | 2006 |
| 1280 | Copolymer 1-related heteropolymer | EKAYAAAAAAKAAAA | 15 | L | None | None | None | Linear | Synthetic | NA (Random copolymer) | T-cells | Inhibits T cell proliferation in response to graft cells, preventing the secretion of cytokines like interleukin 2 (IL-2) and interferon γ (IFN-γ) | In vivo | NA | NA | BALB/c mice, Lewis rats | Skin Grafts Transplantation, Thyroid graft Transplantation | NA | Copolymer 1-related heteropolymers in combination with other immunosuppressive drugs induce a synergistic effect, This is used as copolymer or related hateropolymer | US 20060276390 A1 | 2006 |
| 1281 | Copolymer 1-related heteropolymer | AAKYEAAAAAKAAAA | 15 | L | None | None | None | Linear | Synthetic | NA (Random copolymer) | T-cells | Inhibits T cell proliferation in response to graft cells, preventing the secretion of cytokines like interleukin 2 (IL-2) and interferon γ (IFN-γ) | In vivo | NA | NA | BALB/c mice, Lewis rats | Skin Grafts Transplantation, Thyroid graft Transplantation | NA | Copolymer 1-related heteropolymers in combination with other immunosuppressive drugs induce a synergistic effect, This is used as copolymer or related hateropolymer | US 20060276390 A1 | 2006 |
| 1282 | Copolymer 1-related heteropolymer | AAKYAEAAAAKAAAA | 15 | L | None | None | None | Linear | Synthetic | NA (Random copolymer) | T-cells | Inhibits T cell proliferation in response to graft cells, preventing the secretion of cytokines like interleukin 2 (IL-2) and interferon γ (IFN-γ) | In vivo | NA | NA | BALB/c mice, Lewis rats | Skin Grafts Transplantation, Thyroid graft Transplantation | NA | Copolymer 1-related heteropolymers in combination with other immunosuppressive drugs induce a synergistic effect, This is used as copolymer or related hateropolymer | US 20060276390 A1 | 2006 |
| 1283 | Copolymer 1-related heteropolymer | EAAYAAAAAAKAAAA | 15 | L | None | None | None | Linear | Synthetic | NA (Random copolymer) | T-cells | Inhibits T cell proliferation in response to graft cells, preventing the secretion of cytokines like interleukin 2 (IL-2) and interferon γ (IFN-γ) | In vivo | NA | NA | BALB/c mice, Lewis rats | Skin Grafts Transplantation, Thyroid graft Transplantation | NA | Copolymer 1-related heteropolymers in combination with other immunosuppressive drugs induce a synergistic effect, This is used as copolymer or related hateropolymer | US 20060276390 A1 | 2006 |
| 1284 | Copolymer 1-related heteropolymer | EKKYAAAAAAKAAAA | 15 | L | None | None | None | Linear | Synthetic | NA (Random copolymer) | T-cells | Inhibits T cell proliferation in response to graft cells, preventing the secretion of cytokines like interleukin 2 (IL-2) and interferon γ (IFN-γ) | In vivo | NA | NA | BALB/c mice, Lewis rats | Skin Grafts Transplantation, Thyroid graft Transplantation | NA | Copolymer 1-related heteropolymers in combination with other immunosuppressive drugs induce a synergistic effect, This is used as copolymer or related hateropolymer | US 20060276390 A1 | 2006 |
| 1285 | Copolymer 1-related heteropolymer | EAKYAAAAAAKAAAA | 15 | L | None | None | None | Linear | Synthetic | NA (Random copolymer) | T-cells | Inhibits T cell proliferation in response to graft cells, preventing the secretion of cytokines like interleukin 2 (IL-2) and interferon γ (IFN-γ) | In vivo | NA | NA | BALB/c mice, Lewis rats | Skin Grafts Transplantation, Thyroid graft Transplantation | NA | Copolymer 1-related heteropolymers in combination with other immunosuppressive drugs induce a synergistic effect, This is used as copolymer or related hateropolymer | US 20060276390 A1 | 2006 |
| 1286 | Copolymer 1-related heteropolymer | AEKYAAAAAAAAAAA | 15 | L | None | None | None | Linear | Synthetic | NA (Random copolymer) | T-cells | Inhibits T cell proliferation in response to graft cells, preventing the secretion of cytokines like interleukin 2 (IL-2) and interferon γ (IFN-γ) | In vivo | NA | NA | BALB/c mice, Lewis rats | Skin Grafts Transplantation, Thyroid graft Transplantation | NA | Copolymer 1-related heteropolymers in combination with other immunosuppressive drugs induce a synergistic effect, This is used as copolymer or related hateropolymer | US 20060276390 A1 | 2006 |
| 1287 | Copolymer 1-related heteropolymer | AKEYAAAAAAAAAAA | 15 | L | None | None | None | Linear | Synthetic | NA (Random copolymer) | T-cells | Inhibits T cell proliferation in response to graft cells, preventing the secretion of cytokines like interleukin 2 (IL-2) and interferon γ (IFN-γ) | In vivo | NA | NA | BALB/c mice, Lewis rats | Skin Grafts Transplantation, Thyroid graft Transplantation | NA | Copolymer 1-related heteropolymers in combination with other immunosuppressive drugs induce a synergistic effect, This is used as copolymer or related hateropolymer | US 20060276390 A1 | 2006 |
| 1288 | Copolymer 1-related heteropolymer | AKKYEAAAAAAAAAA | 15 | L | None | None | None | Linear | Synthetic | NA (Random copolymer) | T-cells | Inhibits T cell proliferation in response to graft cells, preventing the secretion of cytokines like interleukin 2 (IL-2) and interferon γ (IFN-γ) | In vivo | NA | NA | BALB/c mice, Lewis rats | Skin Grafts Transplantation, Thyroid graft Transplantation | NA | Copolymer 1-related heteropolymers in combination with other immunosuppressive drugs induce a synergistic effect, This is used as copolymer or related hateropolymer | US 20060276390 A1 | 2006 |
| 1289 | Copolymer 1-related heteropolymer | AKKYAEAAAAAAAAA | 15 | L | None | None | None | Linear | Synthetic | NA (Random copolymer) | T-cells | Inhibits T cell proliferation in response to graft cells, preventing the secretion of cytokines like interleukin 2 (IL-2) and interferon γ (IFN-γ) | In vivo | NA | NA | BALB/c mice, Lewis rats | Skin Grafts Transplantation, Thyroid graft Transplantation | NA | Copolymer 1-related heteropolymers in combination with other immunosuppressive drugs induce a synergistic effect, This is used as copolymer or related hateropolymer | US 20060276390 A1 | 2006 |
| 1290 | Copolymer 1-related heteropolymer | AEAYKAAAAAAAAAA | 15 | L | None | None | None | Linear | Synthetic | NA (Random copolymer) | T-cells | Inhibits T cell proliferation in response to graft cells, preventing the secretion of cytokines like interleukin 2 (IL-2) and interferon γ (IFN-γ) | In vivo | NA | NA | BALB/c mice, Lewis rats | Skin Grafts Transplantation, Thyroid graft Transplantation | NA | Copolymer 1-related heteropolymers in combination with other immunosuppressive drugs induce a synergistic effect, This is used as copolymer or related hateropolymer | US 20060276390 A1 | 2006 |
| 1291 | Copolymer 1-related heteropolymer | KEAYAAAAAAAAAAA | 15 | L | None | None | None | Linear | Synthetic | NA (Random copolymer) | T-cells | Inhibits T cell proliferation in response to graft cells, preventing the secretion of cytokines like interleukin 2 (IL-2) and interferon γ (IFN-γ) | In vivo | NA | NA | BALB/c mice, Lewis rats | Skin Grafts Transplantation, Thyroid graft Transplantation | NA | Copolymer 1-related heteropolymers in combination with other immunosuppressive drugs induce a synergistic effect, This is used as copolymer or related hateropolymer | US 20060276390 A1 | 2006 |
| 1292 | Copolymer 1-related heteropolymer | AEEYKAAAAAAAAAA | 15 | L | None | None | None | Linear | Synthetic | NA (Random copolymer) | T-cells | Inhibits T cell proliferation in response to graft cells, preventing the secretion of cytokines like interleukin 2 (IL-2) and interferon γ (IFN-γ) | In vivo | NA | NA | BALB/c mice, Lewis rats | Skin Grafts Transplantation, Thyroid graft Transplantation | NA | Copolymer 1-related heteropolymers in combination with other immunosuppressive drugs induce a synergistic effect, This is used as copolymer or related hateropolymer | US 20060276390 A1 | 2006 |
| 1293 | Copolymer 1-related heteropolymer | AAEYKAAAAAAAAAA | 15 | L | None | None | None | Linear | Synthetic | NA (Random copolymer) | T-cells | Inhibits T cell proliferation in response to graft cells, preventing the secretion of cytokines like interleukin 2 (IL-2) and interferon γ (IFN-γ) | In vivo | NA | NA | BALB/c mice, Lewis rats | Skin Grafts Transplantation, Thyroid graft Transplantation | NA | Copolymer 1-related heteropolymers in combination with other immunosuppressive drugs induce a synergistic effect, This is used as copolymer or related hateropolymer | US 20060276390 A1 | 2006 |
| 1294 | Copolymer 1-related heteropolymer | EKAYAAAAAAAAAAA | 15 | L | None | None | None | Linear | Synthetic | NA (Random copolymer) | T-cells | Inhibits T cell proliferation in response to graft cells, preventing the secretion of cytokines like interleukin 2 (IL-2) and interferon γ (IFN-γ) | In vivo | NA | NA | BALB/c mice, Lewis rats | Skin Grafts Transplantation, Thyroid graft Transplantation | NA | Copolymer 1-related heteropolymers in combination with other immunosuppressive drugs induce a synergistic effect, This is used as copolymer or related hateropolymer | US 20060276390 A1 | 2006 |
| 1295 | Copolymer 1-related heteropolymer | AAKYEAAAAAAAAAA | 15 | L | None | None | None | Linear | Synthetic | NA (Random copolymer) | T-cells | Inhibits T cell proliferation in response to graft cells, preventing the secretion of cytokines like interleukin 2 (IL-2) and interferon γ (IFN-γ) | In vivo | NA | NA | BALB/c mice, Lewis rats | Skin Grafts Transplantation, Thyroid graft Transplantation | NA | Copolymer 1-related heteropolymers in combination with other immunosuppressive drugs induce a synergistic effect, This is used as copolymer or related hateropolymer | US 20060276390 A1 | 2006 |
| 1296 | Copolymer 1-related heteropolymer | AAKYAEAAAAAAAAA | 15 | L | None | None | None | Linear | Synthetic | NA (Random copolymer) | T-cells | Inhibits T cell proliferation in response to graft cells, preventing the secretion of cytokines like interleukin 2 (IL-2) and interferon γ (IFN-γ) | In vivo | NA | NA | BALB/c mice, Lewis rats | Skin Grafts Transplantation, Thyroid graft Transplantation | NA | Copolymer 1-related heteropolymers in combination with other immunosuppressive drugs induce a synergistic effect, This is used as copolymer or related hateropolymer | US 20060276390 A1 | 2006 |
| 1297 | Copolymer 1-related heteropolymer | EKKYAAAAAAAAAAA | 15 | L | None | None | None | Linear | Synthetic | NA (Random copolymer) | T-cells | Inhibits T cell proliferation in response to graft cells, preventing the secretion of cytokines like interleukin 2 (IL-2) and interferon γ (IFN-γ) | In vivo | NA | NA | BALB/c mice, Lewis rats | Skin Grafts Transplantation, Thyroid graft Transplantation | NA | Copolymer 1-related heteropolymers in combination with other immunosuppressive drugs induce a synergistic effect, This is used as copolymer or related hateropolymer | US 20060276390 A1 | 2006 |
| 1298 | Copolymer 1-related heteropolymer | EAKYAAAAAAAAAAA | 15 | L | None | None | None | Linear | Synthetic | NA (Random copolymer) | T-cells | Inhibits T cell proliferation in response to graft cells, preventing the secretion of cytokines like interleukin 2 (IL-2) and interferon γ (IFN-γ) | In vivo | NA | NA | BALB/c mice, Lewis rats | Skin Grafts Transplantation, Thyroid graft Transplantation | NA | Copolymer 1-related heteropolymers in combination with other immunosuppressive drugs induce a synergistic effect, This is used as copolymer or related hateropolymer | US 20060276390 A1 | 2006 |
| 1299 | Copolymer 1-related heteropolymer | AEYAKAAAAAAAAAA | 15 | L | None | None | None | Linear | Synthetic | NA (Random copolymer) | T-cells | Inhibits T cell proliferation in response to graft cells, preventing the secretion of cytokines like interleukin 2 (IL-2) and interferon γ (IFN-γ) | In vivo | NA | NA | BALB/c mice, Lewis rats | Skin Grafts Transplantation, Thyroid graft Transplantation | NA | Copolymer 1-related heteropolymers in combination with other immunosuppressive drugs induce a synergistic effect, This is used as copolymer or related hateropolymer | US 20060276390 A1 | 2006 |
| 1300 | Copolymer 1-related heteropolymer | AEKAYAAAAAAAAAA | 15 | L | None | None | None | Linear | Synthetic | NA (Random copolymer) | T-cells | Inhibits T cell proliferation in response to graft cells, preventing the secretion of cytokines like interleukin 2 (IL-2) and interferon γ (IFN-γ) | In vivo | NA | NA | BALB/c mice, Lewis rats | Skin Grafts Transplantation, Thyroid graft Transplantation | NA | Copolymer 1-related heteropolymers in combination with other immunosuppressive drugs induce a synergistic effect, This is used as copolymer or related hateropolymer | US 20060276390 A1 | 2006 |
| 1301 | Copolymer 1-related heteropolymer | EKYAAAAAAAAAAAA | 15 | L | None | None | None | Linear | Synthetic | NA (Random copolymer) | T-cells | Inhibits T cell proliferation in response to graft cells, preventing the secretion of cytokines like interleukin 2 (IL-2) and interferon γ (IFN-γ) | In vivo | NA | NA | BALB/c mice, Lewis rats | Skin Grafts Transplantation, Thyroid graft Transplantation | NA | Copolymer 1-related heteropolymers in combination with other immunosuppressive drugs induce a synergistic effect, This is used as copolymer or related hateropolymer | US 20060276390 A1 | 2006 |
| 1302 | Copolymer 1-related heteropolymer | AYKAEAAAAAAAAAA | 15 | L | None | None | None | Linear | Synthetic | NA (Random copolymer) | T-cells | Inhibits T cell proliferation in response to graft cells, preventing the secretion of cytokines like interleukin 2 (IL-2) and interferon γ (IFN-γ) | In vivo | NA | NA | BALB/c mice, Lewis rats | Skin Grafts Transplantation, Thyroid graft Transplantation | NA | Copolymer 1-related heteropolymers in combination with other immunosuppressive drugs induce a synergistic effect, This is used as copolymer or related hateropolymer | US 20060276390 A1 | 2006 |
| 1303 | Copolymer 1-related heteropolymer | AKYAEAAAAAAAAAA | 15 | L | None | None | None | Linear | Synthetic | NA (Random copolymer) | T-cells | Inhibits T cell proliferation in response to graft cells, preventing the secretion of cytokines like interleukin 2 (IL-2) and interferon γ (IFN-γ) | In vivo | NA | NA | BALB/c mice, Lewis rats | Skin Grafts Transplantation, Thyroid graft Transplantation | NA | Copolymer 1-related heteropolymers in combination with other immunosuppressive drugs induce a synergistic effect, This is used as copolymer or related hateropolymer | US 20060276390 A1 | 2006 |
| 1304 | None | CVCVCLLPRYPSAGVFTYLNTKIITFDSVLSKCA | 34 | L | None | None | None | Linear | Synthetic | Native nucloetide sequence capable of expressing GIF activity | Tissue harboring the parasite | Inhibit glycosylation inhibiting factors, which inhibits IgE production | Both | Spleen cells | NA | BALB/c | Hummoral Immune Response assay | NA | NA | US 4749685 | 1988 |
| 1305 | None | CVCVCIIPRYPSAGVFTYINTKIITFDSVISKCA | 35 | L | None | None | None | Linear | Synthetic | Native nucloetide sequence capable of expressing GIF activity | Tissue harboring the parasite | Inhibit glycosylation inhibiting factors, which inhibits IgE production | Both | Spleen cells | NA | BALB/c | Hummoral Immune Response assay | NA | NA | US 4749685 | 1988 |
| 1306 | None | CVCVCMMPRYPSAGVFTYMNTKIITFDSVMSKCA | 36 | L | None | None | None | Linear | Synthetic | Native nucloetide sequence capable of expressing GIF activity | Tissue harboring the parasite | Inhibit glycosylation inhibiting factors, which inhibits IgE production | Both | Spleen cells | NA | BALB/c | Hummoral Immune Response assay | NA | NA | US 4749685 | 1988 |
| 1307 | None | CVCVCLLPRYPSAGVFTYLNTKIITFDSVLSKCA | 37 | L | None | None | None | Linear | Synthetic | Native nucloetide sequence capable of expressing GIF activity | Tissue harboring the parasite | Inhibit glycosylation inhibiting factors, which inhibits IgE production | Both | Spleen cells | NA | BALB/c | Hummoral Immune Response assay | NA | NA | US 4749685 | 1988 |
| 1308 | None | CVCVCIIPRYPSAGVFTYINTKMMTFDSVISKCA | 38 | L | None | None | None | Linear | Synthetic | Native nucloetide sequence capable of expressing GIF activity | Tissue harboring the parasite | Inhibit glycosylation inhibiting factors, which inhibits IgE production | Both | Spleen cells | NA | BALB/c | Hummoral Immune Response assay | NA | NA | US 4749685 | 1988 |
| 1309 | None | CVCVCLLPRYPSAGVFTYLNTKLLTFDSVLSKCA | 39 | L | None | None | None | Linear | Synthetic | Native nucloetide sequence capable of expressing GIF activity | Tissue harboring the parasite | Inhibit glycosylation inhibiting factors, which inhibits IgE production | Both | Spleen cells | NA | BALB/c | Hummoral Immune Response assay | NA | NA | US 4749685 | 1988 |
| 1310 | None | CVCVCLLPRYPSAGVFTYLNTKIITFDSVLSKCA | 40 | L | None | None | None | Linear | Synthetic | Native nucloetide sequence capable of expressing GIF activity | Tissue harboring the parasite | Inhibit glycosylation inhibiting factors, which inhibits IgE production | Both | Spleen cells | NA | BALB/c | Hummoral Immune Response assay | NA | NA | US 4749685 | 1988 |
| 1311 | None | CVCVCLLPRYPSAGVFTYLNTKIITFDSVLSKCA | 41 | L | None | None | None | Linear | Synthetic | Native nucloetide sequence capable of expressing GIF activity | Tissue harboring the parasite | Inhibit glycosylation inhibiting factors, which inhibits IgE production | Both | Spleen cells | NA | BALB/c | Hummoral Immune Response assay | NA | NA | US 4749685 | 1988 |
| 1312 | CKS-17 | LQNRRGLDLLFLKEGGL | 17 | L | None | None | Coupled with carrier protein human serum albumin, bovine serum albumin | Linear | Protein Derived | Human T-cell Leukemia Virus envelope proteins | Human Monocytes | Inhibit CTLL-2 proliferation | Both | Human mononuclear cells, Murine CTLL-2 cells, Balb/3T3 cells, NIH/3T3 | NA | BALB/c and NIH/Swiss mice, Rabbits | Hummoral Immune Response assay, Monocytes O2 release assay | NA | BSA | US 4822606 | 1989 |
| 1313 | CS-1 | AENRRGLDLLFWEQGGL | 17 | L | None | None | None | Linear | Protein Derived | Human T-cell Leukemia Virus envelope proteins | Human Monocytes | Inhibit CTLL-2 proliferation | Both | Human mononuclear cells, Murine CTLL-2 cells, Balb/3T3 cells, NIH/3T4 | NA | BALB/c and NIH/Swiss mice, Rabbits | Hummoral Immune Response assay, Monocytes O2 release assay | NA | BSA | US 4822606 | 1989 |
| 1314 | CS-2 | YQNRLALDYLLAAEEGV | 17 | L | None | None | None | Linear | Protein Derived | Retrovial envelope protein | Human Monocytes | Inhibit CTLL-2 proliferation | Both | Human mononuclear cells, Murine CTLL-2 cells, Balb/3T3 cells, NIH/3T5 | NA | BALB/c and NIH/Swiss mice, Rabbits | Hummoral Immune Response assay, Monocytes O2 release assay | NA | BSA | US 4822606 | 1989 |
| 1315 | CS-3 | LEARILAVERYLKDQQL | 17 | L | None | None | None | Linear | Protein Derived | Human T-cell Leukemia Virus envelope proteins | Human Monocytes | Inhibit CTLL-2 proliferation | Both | Human mononuclear cells, Murine CTLL-2 cells, Balb/3T3 cells, NIH/3T6 | NA | BALB/c and NIH/Swiss mice, Rabbits | Hummoral Immune Response assay, Monocytes O2 release assay | NA | BSA | US 4822606 | 1989 |
| 1316 | CS-SRV 17 | LQNRRGLDLLTAEQGGI | 17 | L | None | None | None | Linear | Protein Derived | Retrovial envelope protein | Human Monocytes | Inhibit CTLL-2 proliferation | Both | Human mononuclear cells, Murine CTLL-2 cells, Balb/3T3 cells, NIH/3T7 | NA | BALB/c and NIH/Swiss mice, Rabbits | Hummoral Immune Response assay, Monocytes O2 release assay | NA | BSA | US 4822606 | 1989 |
