| Primary information |
|---|
| ID | 1268 |
| Peptide Name | NA |
| Sequence | CVCVCLLPRYPSAGVFTYLNTKIITFDSVLSCA |
| Length | 33 |
| Chirality | L |
| N-terminal Modification | None |
| C-terminal Modification | None |
| Chemical Modification | None |
| Linear/ Cyclic | Linear |
| Nature | Protein Derived |
| Source of Origin | Amino acid sequences derived from a human native nucleotide sequence capable of expressing GIF (glycosylation-inhibiting factors) |
| Target | B-cells |
| Mechanism of Action | Glycosylation inhibiting factor activity causing the suppression of immunoglobulin E (IgE) production |
| In vitro/In vivo | In vitro |
| Cell Line | Mesenteric lymph node (MLN) cells |
| Inhibition Concentartion | NA |
| In vivo Model | Lewis Rat |
| Assay | Rosette inhibition assay, tests of the IgE-SF activity |
| Lethal Dose | NA |
| Combination Therapy | NA |
| Pubmed ID | EP 0255394 A2 |
| Year of Publication | 1987 |
| 3-D Structure |  View in Jmol or Download Structure |
