Primary information |
---|
ID | 1304 |
Peptide Name | None |
Sequence | CVCVCLLPRYPSAGVFTYLNTKIITFDSVLSKCA |
Length | 34 |
Chirality | L |
N-terminal Modification | None |
C-terminal Modification | None |
Chemical Modification | None |
Linear/ Cyclic | Linear |
Nature | Synthetic |
Source of Origin | Native nucloetide sequence capable of expressing GIF activity |
Target | Tissue harboring the parasite |
Mechanism of Action | Inhibit glycosylation inhibiting factors, which inhibits IgE production |
In vitro/In vivo | Both |
Cell Line | Spleen cells |
Inhibition Concentartion | NA |
In vivo Model | BALB/c |
Assay | Hummoral Immune Response assay |
Lethal Dose | NA |
Combination Therapy | NA |
Pubmed ID | US 4749685 |
Year of Publication | 1988 |
3-D Structure | View in Jmol or Download Structure |