| Primary information |
|---|
| ID | 1311 |
| Peptide Name | None |
| Sequence | CVCVCLLPRYPSAGVFTYLNTKIITFDSVLSKCA |
| Length | 41 |
| Chirality | L |
| N-terminal Modification | None |
| C-terminal Modification | None |
| Chemical Modification | None |
| Linear/ Cyclic | Linear |
| Nature | Synthetic |
| Source of Origin | Native nucloetide sequence capable of expressing GIF activity |
| Target | Tissue harboring the parasite |
| Mechanism of Action | Inhibit glycosylation inhibiting factors, which inhibits IgE production |
| In vitro/In vivo | Both |
| Cell Line | Spleen cells |
| Inhibition Concentartion | NA |
| In vivo Model | BALB/c |
| Assay | Hummoral Immune Response assay |
| Lethal Dose | NA |
| Combination Therapy | NA |
| Pubmed ID | US 4749685 |
| Year of Publication | 1988 |
| 3-D Structure |  View in Jmol or Download Structure |
