| 1167 | HIV-env 848-863 | RHIPRRIRQGLERILL | 16 | L | None | None | None | Linear | Synthetic | NA | NA | Not Available | In vitro | Human sera | NA | NA | NA | NA | NA | 2455899 | 1988 |
| 1168 | HIV-env 854-863 | IRQGLERILL | 10 | L | None | None | None | Linear | Synthetic | NA | NA | Not Available | In vitro | Human sera | NA | NA | NA | NA | NA | 2455899 | 1988 |
| 1169 | CS-1 (HTLV-1) | AQNRRGLDLLFWEQGGL | 17 | L | None | None | None | Linear | Synthetic | HTLV-I gp21E | NA | Not Available | In vitro | CTL-2 | 3 nmol/well | NA | NA | NA | NA | 2973436 | 1988 |
| 1170 | CS-3 (HIV) | LQARILAVERYLKDQQL | 17 | L | None | None | None | Linear | Synthetic | HIV gp41 | NA | Not Available | In vitro | CTL-2 | 3 nmol/well | NA | NA | NA | NA | 2973436 | 1988 |
| 1171 | CS-2 (Endogenous) | YQNRLALDYLLAAEGGV | 17 | L | None | None | None | Linear | Synthetic | Human genomic DNA | NA | Not Available | In vitro | CTL-2 | NA | NA | NA | NA | NA | 2973436 | 1988 |
| 1172 | Spleen-derived immunosuppressive peptide (SDIP) | not available | 0 | L | None | None | None | Linear | Natural | Bovin spleen | NA | Inhibits the formation of 19 S antibody forming cells | Both | Bovine spleen extract | NA | DBA/2 X C57BL/6 and Balb/c | Plaque-forming cell (PFC) assay | NA | NA | 7217277 | 1981 |
| 1173 | Cyclosporin A | cyclo[Abu-Sar-N(Me)Leu-Val-N(Me)Leu-Ala-D-Ala-N(Me)Leu-N(Me)Leu-N(Me)Val-N(Me)Bmt(E)] | 11 | Mix | None | None | Bmt = butenyl-methyl-threonine, Abu = L-alpha-aminobutyric acid, Sar = sarcosine, N(Me) = Amino acid is N-methylated | Cyclic | Natural | Fungus | NA | Not Available | In vivo | NA | NA | CBA/Ca and (CBA/Ca X C57BL6)F1 mice | Plaque-forming cell (PFC) assay | NA | NA | 6159410 | 1980 |
| 1174 | Immunosuppressive peptide | not available | 0 | L | None | None | None | Linear | Protein Derived | Cohn fraction IV of normal human plasma | NA | Suppresses phytohemagglutinin induced lymphocyte proliferation | Both | Human peripheral lymphocytes | NA | Adult mice (C57BL/6J or CBA) | Phytohemagglutinin (PHA)-induced lymphocyte Proliferation assay and modified Jerne hemolytic plaque technique | NA | NA | 4569799 | 1973 |
| 1175 | Immunoregulatory α-globulin | not available | 0 | L | None | None | None | Linear | Natural | Human Sera | NA | Not Available | Both | Human Sera | NA | Adult CD-l mice | Assay for inhibition of PHA-induced Proliferation | NA | NA | 4135310 | 1975 |
| 1176 | immunoregulatory a-globulin-like peptide | not available | 0 | L | None | None | None | Linear | Natural | Human Sera | NA | Not Available | Both | Human Sera | NA | Adult CD-l mice | NA | NA | NA | 4135310 | 1975 |
| 1177 | Spleen-derived immunosuppressive peptide (SDIP) | not available | 0 | L | None | None | None | Linear | Natural | Not available | NA | Not Available | Both | Spleen Cells | NA | Balb/c or (C57B1/6 x DBA2)Fl hybrids 8-10 weeks old. | Cunningham technique, Mishell and Dutton technique, FTS radioimmunoassay, rosette assay | NA | NA | 6682089 | 1983 |
| 1178 | Spleen-derived inhibiting peptide (SDIP) | not available | 0 | L | None | None | None | Linear | Natural | Not available | NA | Not Available | Both | Spleen cells | NA | (DBA/2 X C57BL/6) strain or Balb/c strain | Plaque-forming cell (PFC) assay | NA | NA | 7226235 | 1981 |
| 1179 | Immunoglobulin-binding factor (IBF) | not available | 0 | L | None | None | None | Linear | Natural | Not available | NA | Not Available | Both | Spleen cells | NA | (DBA/2 X C57BL/6) strain or Balb/c strain | Plaque-forming cell (PFC) assay | NA | NA | 7226235 | 1981 |
| 1180 | Immunosuppressive epitope of retroviral plSE | not available | 17 | L | None | None | None | Linear | Protein Derived | Retroviral protein pl5E | IL-2, TNF-α, protein kinase-C | Inhibits human mitogen and alloantigen-stimulated lymphocyte proliferation, natural killer cell activity, interleukin 1-mediated monocyte tumor killing, interleukin 2 production, immunoglobulin synthesis, TNF-α mRNA expression and protein kinase C activity | Both | U937, P2, JLS-V5 | NA | BALB/c mice (Female, 12- week-old) | NA | NA | NA | 7511054 | 1994 |
| 1181 | CKS-17 | LONRRGLDLLFLKEGGL | 17 | L | None | None | None | Linear | Synthetic | Not available | NA | Not Available | In vitro | U937, P2, JLS-V5 | NA | NA | NA | NA | NA | 7511054 | 1994 |
| 1182 | SMRV-H peptide | EVVLQNRRGLDLLTAEQGGICLALQERCCFYANKS | 35 | D | None | None | None | Linear | Protein Derived | Squirrel monkey retrovirus (SMRV) | NA | Not Available | In vitro | U937, P2, JLS-V5 | NA | NA | NA | NA | NA | 3201749 | 1988 |
| 1183 | SRV-1 peptide | EVVLQNRRGLDLLTAEQGGICLALQEKCCFYANKS | 35 | L | None | None | None | Linear | Protein Derived | Simian retrovirus type-1 | NA | Not Available | In vitro | Human Lymphoblastoid Cell Line | NA | NA | NA | NA | NA | 3201749 | 1988 |
| 1184 | SRV-2 peptide | EVVLQNRRGLDLLTAEQGGICLALQEKCCFYANKS | 35 | L | None | None | None | Linear | Protein Derived | Simian retrovirus type-2 | NA | Not Available | In vitro | Human Lymphoblastoid Cell Line | NA | NA | NA | NA | NA | 3201749 | 1988 |
| 1185 | MPMV | EVVLQNRRGLDLLTAEQGGICLALQEKCCFYANKS | 35 | L | None | None | None | Linear | Protein Derived | Mason-Pfizer monkey virus | NA | Not Available | In vitro | Human Lymphoblastoid Cell Line | NA | NA | NA | NA | NA | 3201749 | 1988 |
| 1186 | REV-A | EVVLQNRRGLDLLTAEQGGICLALQEKCCFYANKS | 35 | L | None | None | None | Linear | Protein Derived | Reticuloendotheliosis-associated virus (REV-A) | NA | Not Available | In vitro | Human Lymphoblastoid Cell Line | NA | NA | NA | NA | NA | 3201749 | 1988 |
| 1187 | FeLV | EVVLQNRRGLDILFLQEGGLCAALKEECCFYADHT | 35 | L | None | None | None | Linear | Protein Derived | Feline leukemia virus (FeLV) | NA | Not Available | In vitro | Human Lymphoblastoid Cell Line | NA | NA | NA | NA | NA | 3201749 | 1988 |
| 1188 | Mo-MLV | EVVLQNRRGLDLLFLKEGGLCAALKEECCFYADHT | 35 | L | None | None | None | Linear | Protein Derived | Moloney murine leukemia virus | NA | Not Available | In vitro | Human Lymphoblastoid Cell Line | NA | NA | NA | NA | NA | 3201749 | 1988 |
| 1189 | RSV | HAVLQNRAAIDFLLLAHGHGCEDVAGMCCFNLSDH | 35 | L | None | None | None | Linear | Protein Derived | Respiratory syncytial virus | NA | Not Available | In vitro | Human Lymphoblastoid Cell Line | NA | NA | NA | NA | NA | 3201749 | 1988 |
| 1190 | HTLV-1 | QYAAQNRRGLDLLFWEQGGLCKALQEQCRFPNITN | 35 | L | None | None | None | Linear | Protein Derived | Human T-cell lymphotropic virus 1 | NA | Not Available | In vitro | Human Lymphoblastoid Cell Line | NA | NA | NA | NA | NA | 3201749 | 1988 |
| 1191 | HTLV-2 | QYAAQNRRGLDLLFWEQGGLCKALQEQCCFLNISN | 35 | L | None | None | None | Linear | Protein Derived | Human T-cell lymphotropic virus 2 | NA | Not Available | In vitro | Human Lymphoblastoid Cell Line | NA | NA | NA | NA | NA | 3201749 | 1988 |
| 1192 | CKS-17 | LQNRRGLDLLFLKEGGL | 17 | L | None | None | None | Linear | Synthetic | NA | NA | Not Available | In vitro | Human Lymphoblastoid Cell Line | NA | NA | NA | NA | NA | 3201749 | 1988 |
| 1193 | SEQ ID NO:1 | ILNRKAIDFLLQRWGGT | 17 | L | None | None | polyethylene glycol conjugated | Linear | Protein Derived | Zaire ebola virus, C-terminus domain of the envelope glycoprotein | CD4+, CD8+ cells | Depletion and inactivation of T Lymphocytes, Modulating IL 2, IL10, IL12 level | In vitro | PBMC | NA | NA | NA | NA | polyethylene glycol conjugated | US 20070185025 A1 | 2007 |
| 1194 | SEQ ID NO:2 | LINRHAIDFLLTRWGGT | 17 | L | None | None | polyethylene glycol conjugated | Linear | Protein Derived | Lake Victoria marburg virus | CD4+, CD8+ cells | Depletion and inactivation of T Lymphocytes, Modulating IL 2, IL10, IL12 level | In vitro | PBMC | NA | NA | NA | NA | polyethylene glycol conjugated | US 20070185025 A1 | 2007 |
| 1195 | SEQ ID NO:3 | ILNRKAIDFLLRRWGGT | 17 | L | None | None | polyethylene glycol conjugated | Linear | Protein Derived | Sudan ebola virus,C-terminus domain of the envelope glycoprotein | CD4+, CD8+ cells | Depletion and inactivation of T Lymphocytes, Modulating IL 2, IL10, IL12 level | In vitro | PBMC | NA | NA | NA | NA | polyethylene glycol conjugated | US 20070185025 A1 | 2007 |
| 1196 | SEQ ID NO:4 | LLNRKAIDFLLQRWGGT | 17 | L | None | None | polyethylene glycol conjugated | Linear | Protein Derived | Reston ebola virus, C-terminus domain of the envelope glycoprotein | CD4+, CD8+ cells | Depletion and inactivation of T Lymphocytes, Modulating IL 2, IL10, IL12 level | In vitro | PBMC | NA | NA | NA | NA | polyethylene glycol conjugated | US 20070185025 A1 | 2007 |
| 1197 | SEQ ID NO:5 | ILNRKAIDFLLQRWGGT | 17 | L | None | None | polyethylene glycol conjugated | Linear | Protein Derived | Ivory coast ebola virus, C-terminus domain of the envelope glycoprotein | CD4+, CD8+ cells | Depletion and inactivation of T Lymphocytes, Modulating IL 2, IL10, IL12 level | In vitro | PBMC | NA | NA | NA | NA | polyethylene glycol conjugated | US 20070185025 A1 | 2007 |
| 1198 | SEQ ID NO 1 | VVGGYNCEMNSQVAVYYFGEYLC | 26 | L | None | None | None | Linear | Natural | Rattus rattus | NA | Affecting lymph node cell proliferation | In vivo | NA | NA | Mice, DTH model, CA model | Contact sensitivity in mice | NA | NA | US 7195759 B2 | 2007 |
| 1199 | LffX-I | VGINVKCKHSRQCLKPCKDAGMRFGKCTNGKCHCTPK | 37 | L | None | None | None | Linear | Natural | Scorpion venom | Kv1.3 potassium channels of T cells | high specificity binding Kv1.3 potassium channels of T cells | Both | C0S-7 cells | 1.08 pM | Arthritic Lewis rats, EAE model of Wistar rats | NA | NA | NA | CN 101423550 B | 2012 |
| 1200 | LWX-AD-1 | NEAVPTGGCPFSDFFCAKRCKDMKFGNTGRCTGPNKTVCKCSI | 43 | L | None | None | None | Linear | Natural | Scorpion venom | Kv1.3 potassium channels of T cells | high specificity binding Kv1.3 potassium channels of T cells | Both | C0S-7 cells | 0.52 nM | Arthritic Lewis rats, EAE model of Wistar rats | NA | NA | NA | CN 101423550 B | 2012 |
| 1201 | 11R-VEET | RRRRRRRRRRRMAGPHPVIVITGPHEE | 27 | L | None | None | None | Linear | Synthetic | NA | T cells, Transcription of IL-2 gene | Suppressive agent of NFAT activation | Both | Jurkat | NA | BALB/c mouse, H-2d mouse, C3H/HeN mouse H-2k | NA | NA | NA | US 7659249 B2 | 2010 |
| 1202 | A1HS1 | II-Sta-PYVPL | 8 | L | None | None | Sta = (3S, 4S) -4- amino-3-hydroxy-6-methyl-heptanoic acid(C8H17NO3) | Cyclic | Synthetic | NA | Lymphocytes, Macrophages | Influence of phagocytic function of macrophages, and the retarding effect of the proliferation of Lymphocytes | Both | Spleen Lymphocyte | NA | BALB / C mice | Delayed-type hypersensitivity (DTH) test, Lymphocyte Proliferation test, MTT | NA | | CN 101289499 B | 2010 |
| 1203 | A3HS1 | IIPPYV-Sta-L | 8 | L | None | None | Sta = Statine | Cyclic | Synthetic | NA | Lymphocytes, Macrophages | Influence of phagocytic function of macrophages, and the retarding effect of the proliferation of Lymphocytes | Both | Spleen Lymphocyte | NA | BALB / C mice | Delayed-type hypersensitivity (DTH) test, Lymphocyte Proliferation test, MTT | NA | | CN 101289498 B | 2010 |
| 1204 | A4HS1 | II-Sta-Sta-YVPL | 8 | L | None | None | Sta = Statine | Cyclic | Synthetic | NA | Lymphocytes, Macrophages | Influence of phagocytic function of macrophages, and the retarding effect of the proliferation of Lymphocytes | Both | Spleen Lymphocyte | NA | BALB / C mice | Delayed-type hypersensitivity (DTH) test, Lymphocyte Proliferation test, MTT | NA | | CN 101289497 A | 2008 |
| 1205 | NA | LQNRRGLDILFLQEGGLC | 18 | L | None | None | None | Linear | Synthetic | Retro virus, Feline leukemia virus (FLV) | NA | Inhibiting T-cell proliferation | In vitro | Spleen cells | NA | Murine (C57BL/6 strain) | Inhibition of Concanavalin A-induced T-cell Proliferation of murine | NA | NA | WO 1988005783 A1 | 1988 |
| 1206 | NA | AALKEECCFLKEEC | 14 | L | None | None | None | Linear | Synthetic | Retro virus | T-cells | Inhibiting T-cell proliferation | In vitro | Spleen cells | NA | Murine (C57BL/6 strain) | Inhibition of Concanavalin A-induced T-cell Proliferation of murine | NA | NA | WO 1988005783 A1 | 1988 |
| 1207 | NA | QEGGLCAALKEEC | 13 | L | None | None | None | Linear | Synthetic | Retro virus | T-cells | Inhibiting T-cell proliferation | In vitro | Spleen cells | NA | Murine (C57BL/6 strain) | Inhibition of Concanavalin A-induced T-cell Proliferation of murine | NA | NA | WO 1988005783 A1 | 1988 |
| 1208 | NA | QREKRAVGIGALFLGFLG | 18 | L | None | None | None | Linear | Synthetic | Retro virus | T-cells | Inhibiting T-cell proliferation | In vitro | Spleen cells | NA | Murine (C57BL/6 strain) | Inhibition of Concanavalin A-induced T-cell Proliferation of murine | NA | NA | WO 1988005783 A1 | 1988 |
| 1209 | NA | QLTVWGIKQLQARIL | 15 | L | None | None | None | Linear | Synthetic | Retro virus | T-cells | Inhibiting T-cell proliferation | In vitro | Spleen cells | NA | Murine (C57BL/6 strain) | Inhibition of Concanavalin A-induced T-cell Proliferation of murine | NA | NA | WO 1988005783 A1 | 1988 |
| 1210 | NA | AQNRRGLDLLFWEQGGLC | 18 | L | None | None | None | Linear | Synthetic | Retro virus | T-cells | Inhibiting T-cell proliferation | In vitro | Spleen cells | NA | Murine (C57BL/6 strain) | Inhibition of Concanavalin A-induced T-cell Proliferation of murine | NA | NA | WO 1988005783 A1 | 1988 |
| 1211 | NA | HAwY | 4 | Mix | None | None | A-D-Glu or D-iGlu, Y-OH or a substituted amide(C1-C3) | Linear | Natural | Total tissue extracts | Bone marrow cells, Hematopoietic progenitor cells | Reduces amount of ekzokolony cells, reduce KOE-C pool sizes | Both | Hematopoietic progenitor Cells from mice | NA | Mice | NA | NA | NA | RU2123859 (C1) | 1998 |
| 1212 | SEQ ID NO: 1 | ILAKFLHWL | 9 | L | None | None | Inventors midified C- or at the N-terminus of the peptides with stabilizing groups, groups for increasing the water solubility, luminescent markers, fluorescent markers, radioactive markers, metal markers, polymeric markers, antibodies, enzymes, epitope tags, amino acid, D- or L-amino acids, serine, glycine, aspartate, sugar groups, glucuronic acid, sulfate moieties and polyethylene glycol. for experiments | Linear | Protein Derived | human telomerase reverse transcriptase | Proteasome | Inhibits the overall activity of the proteasome | In vitro | HeLa, Saos | NA | NA | NA | NA | | DE 102006025146 A1 | 2007 |
| 1213 | SEQ ID NO: 2 | AEHRLREEILAKFLHWLMSVYVVEL | 25 | L | None | None | None | Linear | Protein Derived | human telomerase reverse transcriptase | Proteasome | Inhibits the overall activity of the proteasome | In vitro | HeLa, Saos | NA | NA | NA | NA | NA | DE 102006025146 A1 | 2007 |
| 1214 | SEQ ID NO: 3 | MLMYILAKFLHWLGGYILAKFLHWLGGYILAKFLHWL | 37 | L | None | None | None | Linear | Protein Derived | human telomerase reverse transcriptase | Proteasome | Inhibits the overall activity of the proteasome | In vitro | HeLa, Saos | NA | NA | NA | NA | NA | DE 102006025146 A1 | 2007 |
| 1215 | SEQ ID NO: 4 | RLMYDILAKFLHWLGPSEKRVWMS | 24 | L | None | None | None | Linear | Protein Derived | human telomerase reverse transcriptase | Proteasome | Inhibits the overall activity of the proteasome | In vitro | HeLa, Saos | NA | NA | NA | NA | NA | DE 102006025146 A1 | 2007 |
| 1216 | SEQ ID NO: 5 | AHGVILAKFLHWLSTAPPAHGVILAKFLHWLSTAPPA | 37 | L | None | None | None | Linear | Protein Derived | human telomerase reverse transcriptase | Proteasome | Inhibits the overall activity of the proteasome | In vitro | HeLa, Saos | NA | NA | NA | NA | NA | DE 102006025146 A1 | 2007 |
