Primary information |
---|
ID | 1216 |
Peptide Name | SEQ ID NO: 5 |
Sequence | AHGVILAKFLHWLSTAPPAHGVILAKFLHWLSTAPPA |
Length | 37 |
Chirality | L |
N-terminal Modification | None |
C-terminal Modification | None |
Chemical Modification | None |
Linear/ Cyclic | Linear |
Nature | Protein Derived |
Source of Origin | human telomerase reverse transcriptase |
Target | Proteasome |
Mechanism of Action | Inhibits the overall activity of the proteasome |
In vitro/In vivo | In vitro |
Cell Line | HeLa, Saos |
Inhibition Concentartion | NA |
In vivo Model | NA |
Assay | NA |
Lethal Dose | NA |
Combination Therapy | NA |
Pubmed ID | DE 102006025146 A1 |
Year of Publication | 2007 |
3-D Structure | View in Jmol or Download Structure |